![]() |
||||||
| Home | List proteins by tissue | Protein search | Downloads | Links | ||
| Protein: 328784477 XP_623955.3 PREDICTED: cytochrome P450 6k1 |
Distribution (mouse over here![]() Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | |||||
| Scape | 12.6 | 87.4 | 0.14416476 | ||
| Brain | |||||
| Crop | 17.7* | 5.3* | 77 | 0.22987013 | 0.06883117 |
| Eye | |||||
| Intestine | |||||
| Leg, front | 98.7* | 1.3 | 75.92308 | ||
| Leg, middle | 98.8* | 1.2 | 82.333336 | ||
| Leg, rear | 51.7* | 43.9* | 4.4 | 11.75 | 9.977273 |
| Mandibular gland | |||||
| Rectum | |||||
| Salivary gland, cerebral | |||||
| Salivary gland, thoracic | |||||
| Sternite | 3.3* | 13.5* | 83.2 | 0.039663464 | 0.16225961 |
| Tergite | 80.6 | 19.4 | 4.1546392 | ||
| Ventriculus | |||||
| Thoracic muscle | |||||
| Fat body | 0.8* | 65.3 | 33.9 | 0.02359882 | 1.9262537 |
| Malpighian tubules | 45.4* | 36.6 | 18.1 | 2.5082872 | 2.0220995 |
| Nerve chord | |||||
| Poison sac | |||||
| Sting | |||||
| Heart | 0.4* | 85.6* | 14 | 0.028571429 | 6.114286 |
| Hypopharyngeal gland | |||||
| Galea | |||||
| Glossa | |||||
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 19.9 | 54.1 | 34 | 0.5852941 | 1.5911765 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MAMQNSLFMPIIFSIAFFVIILILYLKYTRTYWLRRGVPTVPGHWLFGNIKKILDLKKPP AYVISDIYQKCSENDDILGIYIFFKPFLLIKDPAIIKQILIKDFNYFPDRNFTIQSFYDE IGNKSLFTLKNPQWKYLRTKLSPIFSSAKVKKLFHLMVEAANSMNKYLDDEFSNDTKTKT IMIKDVTLKYTTNVISSVAFGIQVNSFNPKTIQFYEEAQKGLKTTFSRSMQLCISFFFPK LSPYLNTRMLGSSTNFFRKVFWNSMDNREITKTKREDLIDSLMELKNAKQDKDFKFEGDA LLSQSAIFFIAGRETSISIICLTLYELAKHPEIQKRTREEINEKLKEHGMTYEGVQSMKY LHQVVSEILRIYPPTPIIDRVAVADYKIPGTDIVIEKGTSVFIVLTALHNDPKYHPDPLR FNPDRFSDENKENIKPFTYIPFGEGPRICIGARIGQLQSIIGLITIIKNYEISFISKCKG DLDVRNIFITPINDFSDLDVRNIFITPINDFSLNLTKI |
|
| |