| Protein: 328780510 XP_003249812.1 PREDICTED: LOW QUALITY PROTEIN: 40S ribosomal protein S27 |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | |||||
| Scape | |||||
| Brain | |||||
| Crop | 49.8 | 50.2 | 0.9920319 | ||
| Eye | |||||
| Intestine | |||||
| Leg, front | |||||
| Leg, middle | |||||
| Leg, rear | 18.2* | 81.8 | 0.22249389 | ||
| Mandibular gland | |||||
| Rectum | |||||
| Salivary gland, cerebral | |||||
| Salivary gland, thoracic | 25.6 | 43.2 | 31.2 | 0.82051283 | 1.3846154 |
| Sternite | |||||
| Tergite | |||||
| Ventriculus | |||||
| Thoracic muscle | |||||
| Fat body | 18.6 | 44.1 | 37.3 | 0.49865952 | 1.1823056 |
| Malpighian tubules | 45 | 19.6 | 35.4 | 1.2711865 | 0.5536723 |
| Nerve chord | 53.2 | 46.8 | 1.1367521 | ||
| Poison sac | |||||
| Sting | |||||
| Heart | 15.8 | 59 | 25.1 | 0.6294821 | 2.3505976 |
| Hypopharyngeal gland | 3.7 | 96.3 | 0.038421597 | ||
| Galea | |||||
| Glossa | |||||
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 31.6 | 33.9 | 50.5 | 0.62574255 | 0.6712871 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MPLAKDFLHPSPAEEKRKHKLKRLVQKPNSYFMDVKCPGCYAIKTIFSHAQRSVECDGCR TILCTSTGGKARLTXGCSFRRKVQC |
 Top
| |