| Protein: 110757651 XP_392405.3 PREDICTED: heat shock protein beta-1-like isoform 1 |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 18.4 | 46.3 | 35.3 | 0.52124643 | 1.3116148 |
| Scape | 30.6 | 34.4 | 35 | 0.8742857 | 0.98285717 |
| Brain | 43.3 | 38 | 18.6 | 2.327957 | 2.0430107 |
| Crop | 43.7 | 13 | 43.3 | 1.0092379 | 0.30023095 |
| Eye | 35.7 | 35.7 | 28.6 | 1.2482518 | 1.2482518 |
| Intestine | 14.3 | 46.1 | 39.6 | 0.3611111 | 1.1641414 |
| Leg, front | 30.9 | 29.2 | 39.9 | 0.7744361 | 0.7318296 |
| Leg, middle | 29.7 | 30.7 | 39.5 | 0.7518987 | 0.7772152 |
| Leg, rear | 31.5 | 31.6 | 36.9 | 0.85365856 | 0.85636854 |
| Mandibular gland | 46.4 | 11.2 | 42.4 | 1.0943396 | 0.26415095 |
| Rectum | 25.4 | 48.8 | 25.7 | 0.98832685 | 1.8988327 |
| Salivary gland, cerebral | 21.6 | 40.9 | 37.5 | 0.576 | 1.0906667 |
| Salivary gland, thoracic | 39.6 | 25.7 | 34.8 | 1.137931 | 0.7385057 |
| Sternite | 34 | 33.5 | 32.5 | 1.0461539 | 1.0307692 |
| Tergite | 50.7 | 18.8 | 30.5 | 1.6622951 | 0.61639345 |
| Ventriculus | 5.7 | 14.3 | 80 | 0.07125 | 0.17875 |
| Thoracic muscle | 38.1 | 47.8 | 14 | 2.7214286 | 3.4142857 |
| Fat body | 30 | 33.9 | 36.1 | 0.83102494 | 0.9390582 |
| Malpighian tubules | 64* | 11.2 | 24.8 | 2.580645 | 0.4516129 |
| Nerve chord | 48.7 | 18.7 | 32.5 | 1.4984615 | 0.5753846 |
| Poison sac | 47.2 | 52.8 | 0.8939394 | ||
| Sting | 36.8 | 63.2 | 0.5822785 | ||
| Heart | 34 | 19.5 | 46.5 | 0.7311828 | 0.41935483 |
| Hypopharyngeal gland | 74.2 | 25.8 | 2.875969 | ||
| Galea | 23.3 | 39.5 | 37.1 | 0.6280323 | 1.06469 |
| Glossa | 26.8 | 32.8 | 40.4 | 0.6633663 | 0.8118812 |
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 33.3 | 33.1 | 37.4 | 0.8903743 | 0.88502675 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MADSGIKRNIPIKLGDFSVIDTEFSNIRERFDAEMRKMEDEMSRFRSELMNRESNNFFKS TTSRHHTSTSEHRTSTTSKSEGWDKVDPAAPPTRSAFDSFKSTTTQSTQNSSLSPPHDSA WLDGLNSPLIQDEGDSKCLKLRFDVSQYTPEEIVVKTVDNKLLVHAKHEEKTESKSVYRE YNREFLLPKGTNPESIKSSLSKDGVLTVEAPLPAIGTGEKLIPIAHQ |
 Top
| |