| Protein: 66515294 XP_394769.2 PREDICTED: v-type proton ATPase subunit D 1-like isoform 1 |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 23.8 | 33.6 | 42.7 | 0.55737704 | 0.78688526 |
| Scape | 37.3 | 25.8 | 36.9 | 1.01084 | 0.699187 |
| Brain | 37.8 | 62.2 | 0.60771704 | ||
| Crop | 52.4 | 47.6 | 1.1008403 | ||
| Eye | |||||
| Intestine | 38.2 | 24.8 | 37 | 1.0324324 | 0.67027026 |
| Leg, front | 42.7 | 20.4 | 36.9 | 1.1571816 | 0.55284554 |
| Leg, middle | 57.1 | 42.9 | 1.3310024 | ||
| Leg, rear | 29 | 38.7 | 32.3 | 0.8978328 | 1.1981424 |
| Mandibular gland | |||||
| Rectum | |||||
| Salivary gland, cerebral | |||||
| Salivary gland, thoracic | 64 | 5.8* | 30.2 | 2.1192052 | 0.19205298 |
| Sternite | 67.4 | 32.6 | 2.0674846 | ||
| Tergite | |||||
| Ventriculus | 33.8 | 66.2 | 0.51057404 | ||
| Thoracic muscle | |||||
| Fat body | 38.2 | 36.6 | 25.2 | 1.5158731 | 1.4523809 |
| Malpighian tubules | 28.6 | 34.7 | 36.8 | 0.77717394 | 0.9429348 |
| Nerve chord | 26.7 | 22 | 51.3 | 0.5204678 | 0.4288499 |
| Poison sac | |||||
| Sting | 54.5 | 45.5 | 1.1978022 | ||
| Heart | 23.7 | 25.7 | 50.6 | 0.46837944 | 0.5079051 |
| Hypopharyngeal gland | 63.9 | 36.1 | 1.7700831 | ||
| Galea | |||||
| Glossa | 52 | 48 | 1.0833334 | ||
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 37.2 | 37 | 42.3 | 0.8794326 | 0.8747045 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MSGKEKLAIFPSRGAQMLMKSRLHGAQKGHGLLKKKADALQMRFRLILGKIIETKTLMGE VMKEAAFSLAEAKFATGDFNQVVLQNVTKAQIKIRSKKDNVAGVNLPVFESYQDGTDTYE LAGLARGGQQLAKLKKNYQRAIKLLVELASLQTSFVTLDEVIKITNRRVNAIEHVIIPRI EKTLAYIISELDELEREEFYRLKKIQDKKKQAKAKLEAARAEMIASGKDVEAANMLDEGD DDILF |
 Top
| |