| Protein: 147902613 NP_001011626.2 profilin |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 31.7 | 31.4 | 36.9 | 0.8590786 | 0.8509485 |
| Scape | 37.4 | 29.8 | 32.7 | 1.1437309 | 0.91131496 |
| Brain | 43.7 | 56.3 | 0.7761989 | ||
| Crop | 40.8 | 27.8 | 31.4 | 1.299363 | 0.88535035 |
| Eye | 78.7 | 21.3 | 3.6948357 | ||
| Intestine | 29.5 | 33.7 | 36.8 | 0.80163044 | 0.9157609 |
| Leg, front | 32.5 | 30.8 | 36.7 | 0.8855586 | 0.83923703 |
| Leg, middle | 31.8 | 34.1 | 34.1 | 0.9325513 | 1 |
| Leg, rear | 24.7 | 41.3 | 34 | 0.7264706 | 1.2147058 |
| Mandibular gland | 85 | 15 | 5.6666665 | ||
| Rectum | 26.7 | 50.1 | 23.2 | 1.1508621 | 2.1594827 |
| Salivary gland, cerebral | 32.7 | 33.9 | 33.4 | 0.97904193 | 1.0149701 |
| Salivary gland, thoracic | 30 | 37.3 | 32.6 | 0.9202454 | 1.1441718 |
| Sternite | 60.9* | 32.6 | 6.5 | 9.369231 | 5.0153847 |
| Tergite | 81.7 | 11.6 | 6.6 | 12.378788 | 1.7575758 |
| Ventriculus | 3.3* | 10.7* | 86 | 0.038372092 | 0.1244186 |
| Thoracic muscle | |||||
| Fat body | 74 | 14.5 | 11.5 | 6.4347825 | 1.2608696 |
| Malpighian tubules | 36.9 | 24.5 | 38.6 | 0.95595855 | 0.634715 |
| Nerve chord | 47.1 | 24.6 | 28.3 | 1.6643109 | 0.8692579 |
| Poison sac | 54.7 | 45.3 | 1.2075055 | ||
| Sting | 40.7 | 59.3 | 0.68634063 | ||
| Heart | 41.3 | 29.9 | 28.8 | 1.4340278 | 1.0381944 |
| Hypopharyngeal gland | 41.9 | 58.1 | 0.7211704 | ||
| Galea | 18.5 | 38.2 | 43.4 | 0.42626727 | 0.88018435 |
| Glossa | 23.5 | 29.2 | 47.3 | 0.49682876 | 0.61733615 |
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 41.4 | 32.5 | 35.4 | 1.1694915 | 0.9180791 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MSWQDYVDKQLLASRCVTKAAIAGHDGNLWAKSEGFEVSKEELTKLVQGFEEQDILTSSG VTLAGNRYIYLSGTDRVIRAKLGKVGVHCMKTTQAVVVSLYEDPIQPQQAASVVEKLGDY LVSCGY |
 Top
| |