Home List proteins by tissue Protein search Downloads Links
Protein: 58585086 NP_001011572.1 transferrin 1
Distribution (mouse over here
Sample of a protein distribution map.
for a definition map of the organs displayed below):
Drone Queen Worker











































































































































































































































The above diagram is generated from the following data:
(Organs are coloured according to percent relative expression - 100% = black, 0% = white)

Tissues Drone(D)% Queen(Q)% Worker(W)%     D/W         Q/W    
Flagellum 3.9* 86.3* 9.8 0.39795917 8.806123
Scape 5* 78.7* 16.3 0.30674848 4.828221
Brain 68.4 31.6 2.164557
Crop 39.7 17.3 43 0.9232558 0.40232557
Eye 38.6 40.7 20.7 1.8647343 1.9661835
Intestine 3.9* 36.9 59.2 0.06587838 0.6233108
Leg, front 7.4* 71.6* 21 0.35238096 3.4095237
Leg, middle 7.6* 65.5 26.9 0.2825279 2.4349442
Leg, rear 12.8 56.1 31.1 0.41157556 1.8038585
Mandibular gland 11.7 8.3 80 0.14625 0.10375
Rectum 12.2 20.8 67 0.18208955 0.31044775
Salivary gland, cerebral 5.4 54 40.5 0.13333334 1.3333334
Salivary gland, thoracic 4.4* 57.8 37.9 0.11609498 1.525066
Sternite 7.2 62 30.8 0.23376623 2.012987
Tergite 4 18.4 77.6 0.05154639 0.2371134
Ventriculus 0.6* 66.3 33.2 0.018072288 1.9969879
Thoracic muscle 7* 91.2* 1.8 3.8888888 50.666668
Fat body 6.2 18.1 75.7 0.08190224 0.23910172
Malpighian tubules 4.6* 21.4* 74 0.06216216 0.2891892
Nerve chord 3.3* 69.7 27 0.12222222 2.5814815
Poison sac
Sting 46.3 53.7 0.8621974
Heart 7.5 30.9 61.5 0.12195122 0.502439
Hypopharyngeal gland 46.5 53.5 0.86915886
Galea 2.8* 63.1 34.1 0.08211144 1.8504399
Glossa 2.2* 53.7 44.2 0.049773756 1.2149321
An asterisk (*) on D or Q values denote a significance difference from W (p<0.05).
Drone(D)% Queen(Q)% Worker(W)%     D/W         Q/W    
Whole Body Average 9 50 42.1 0.21377672 1.1876484
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their
whole body averages are significantly different (p<0.05) from each other.
Sequence: MMLRCNIWTLAVNVLFVNSFLFVIAAQDSSGRIFTICVPEIYSKECDEMKKDSAVKGIPV
SCISGRDRYECIEKVGKKEADVVAVDPEDMYLAVKDNKLASNAGYNVIEQVRTKEEPHAP
YRYEAVAVIHKDLPINNVQGLRGLKSCHTGVGRNVGYKIPITKLTAMGVLNNLHDPEYSA
RENELRALSSLFSKGCLVGTWSPDPAINRRLKETYSNMCALCEKPEVCDYPDIYSGYEGA
LRCLAHNGGEIAWTKVIYVKRFFGLPVGVTAAIPTSENPADYRYFCPDGSKVPIDANTKP
CTWAARPWQGYMTNNGVNNVEAVQKELTDLGKLGEEEKADWWKDIMLLNEKTLAVPAPPV
LPENHLKNAKYLDVIERNSGATDKIIRWCTWSEGDLEKCKALTRAAYSRDVRPKYDCTLE
KSQDDCLKAIKENNADLTVVSGGSVLRATKEYNTVPIIAESYGSGSTNFNERPAVAVVSK
SSSINKLEDLRNKKSCHSGYKDSFAGWTAPIYTLKRKGLIKSENEAADFFSGSCAPGAPL
DSKLCQQCVGNLASNNDRIRQVTKCKATNEETYRGGKGALSCLLDGKGDVAFVPLTALSE
EGVQSKDLALICPDGGRAEINEWERCNLGLEPPRVILSSGAKSPTVLEELTHGTLAASTL
YSKRPDLLHLFGSWSNRPNLLFKDEAKDLVSVNKSWNKWNDWQETQNNYGAA

Top