![]() |
||||||
| Home | List proteins by tissue | Protein search | Downloads | Links | ||
| Protein: 66499807 XP_624501.1 PREDICTED: glutathione S-transferase omega-1 |
Distribution (mouse over here![]() Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 29.9 | 37.3 | 32.8 | 0.9115854 | 1.1371951 |
| Scape | 13.9 | 54.9 | 31.2 | 0.44551283 | 1.7596154 |
| Brain | 36.5 | 35.8 | 27.6 | 1.3224638 | 1.2971015 |
| Crop | |||||
| Eye | |||||
| Intestine | 24.5 | 39.2 | 36.4 | 0.6730769 | 1.0769231 |
| Leg, front | 63.5 | 36.5 | 1.7397261 | ||
| Leg, middle | 26.2 | 46.3 | 27.5 | 0.95272726 | 1.6836363 |
| Leg, rear | 44.9 | 55.1 | 0.81488204 | ||
| Mandibular gland | |||||
| Rectum | |||||
| Salivary gland, cerebral | |||||
| Salivary gland, thoracic | 53 | 11.8 | 35.2 | 1.5056819 | 0.33522728 |
| Sternite | |||||
| Tergite | |||||
| Ventriculus | |||||
| Thoracic muscle | |||||
| Fat body | |||||
| Malpighian tubules | |||||
| Nerve chord | 69.7 | 30.3 | 2.30033 | ||
| Poison sac | |||||
| Sting | |||||
| Heart | 70.5 | 29.5 | 2.3898306 | ||
| Hypopharyngeal gland | |||||
| Galea | |||||
| Glossa | |||||
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 32.7 | 47.7 | 34.2 | 0.95614034 | 1.3947369 |
|
|||||
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MSSKHLTIGSVAPPIVPGKIRLYSMRFCPYAQRIHLVLDAKHIPHDVVYVNLTHKPDWLL EKSPLGKVPCIELEGGEILYESLVIAEYLDDTYPQNKLYPNDPLARAKDKLLIGRFNSVI NTMCKLFINTSIDQDIFDEALSELELFERELASRGTPFFHGNSPGMLDFMIWPWWERSNT IKMLRGDQFTIPHDRFKRLLEWRSAMKENPAIRSNYLDTEIHAKYMQSRRAGTPQYDLIT D |
|
| |