| Protein: 94158711 NP_001035297.1 odorant binding protein 17 |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 5.7* | 72.9* | 21.4 | 0.26635513 | 3.406542 |
| Scape | 25.5* | 72.7* | 1.8 | 14.166667 | 40.38889 |
| Brain | |||||
| Crop | |||||
| Eye | |||||
| Intestine | |||||
| Leg, front | 49.3* | 31.4 | 19.3 | 2.5544043 | 1.626943 |
| Leg, middle | 41.5 | 35.5 | 23 | 1.8043479 | 1.5434783 |
| Leg, rear | 30.4 | 39.7 | 29.9 | 1.0167224 | 1.3277591 |
| Mandibular gland | 1.9 | 86.1 | 12 | 0.15833333 | 7.175 |
| Rectum | |||||
| Salivary gland, cerebral | 41 | 59 | 0.69491524 | ||
| Salivary gland, thoracic | |||||
| Sternite | 50.9 | 26 | 23.1 | 2.2034633 | 1.1255411 |
| Tergite | 14.3 | 76 | 9.7 | 1.4742268 | 7.8350515 |
| Ventriculus | |||||
| Thoracic muscle | |||||
| Fat body | 52.5 | 47.5 | 1.1052631 | ||
| Malpighian tubules | |||||
| Nerve chord | 8.5 | 62.1 | 29.3 | 0.2901024 | 2.119454 |
| Poison sac | |||||
| Sting | 27.5 | 72.5 | 0.37931034 | ||
| Heart | 34.1 | 36.6 | 29.3 | 1.1638225 | 1.2491467 |
| Hypopharyngeal gland | 81.1 | 18.9 | 4.291005 | ||
| Galea | 23.6 | 49.3 | 27 | 0.8740741 | 1.825926 |
| Glossa | 40.9 | 34.2 | 24.9 | 1.6425703 | 1.373494 |
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 27.2 | 51.5 | 28 | 0.9714286 | 1.8392857 |
|
|||||
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MKTIVIISAICVCVSAMTLDELKSGLHTVQSVCMKEIGTAQQIIDDINEGKINMDDENVL LFIECTMKKFNVVDENANFNEKISSDIVRAVLNDNEADQLLAECSPISDPNALIKISKIL ECFFKYKTINQILNS |
 Top
| |