![]() |
||||||
| Home | List proteins by tissue | Protein search | Downloads | Links | ||
| Protein: 328788965 XP_001122551.2 PREDICTED: TOM1-like protein 2-like |
Distribution (mouse over here![]() Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 40.6 | 27.4 | 31.9 | 1.2727273 | 0.85893416 |
| Scape | 27.6 | 40.3 | 32.1 | 0.8598131 | 1.2554517 |
| Brain | 43.8 | 56.2 | 0.77935946 | ||
| Crop | |||||
| Eye | |||||
| Intestine | |||||
| Leg, front | 50.1 | 49.9 | 1.004008 | ||
| Leg, middle | 53.4 | 46.6 | 1.1459228 | ||
| Leg, rear | |||||
| Mandibular gland | |||||
| Rectum | |||||
| Salivary gland, cerebral | |||||
| Salivary gland, thoracic | 26.5 | 27.4 | 46.1 | 0.5748373 | 0.5943601 |
| Sternite | |||||
| Tergite | |||||
| Ventriculus | |||||
| Thoracic muscle | |||||
| Fat body | |||||
| Malpighian tubules | 27.2 | 44.5 | 28.3 | 0.96113074 | 1.5724381 |
| Nerve chord | 56.6 | 43.4 | 1.3041475 | ||
| Poison sac | |||||
| Sting | |||||
| Heart | 0.5* | 99.5 | 0.005025126 | ||
| Hypopharyngeal gland | |||||
| Galea | |||||
| Glossa | |||||
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 29.8 | 41 | 48.2 | 0.6182573 | 0.8506224 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MSFFGVNVNPFSTPVGQKIEQATDGTLPSENWTLNMEICDIINETEDGPRDAIKAIKRRL NQAAGKNYTIVMYTLTVLETCVKNCGKRFHALACSREFVQELVKLIGPKNEPPTAVQEKV LSLIQTWADTFRHQPHTQGVVQIYQELKVKGIQFPMTDLDAMAPIITPERSVPELEQNVM NIPTVEQQSTTSITPQMQQSQNQSSGQLTMLNEQQMAKLQSELDVVQGNMRVLSEMLAYF TSSDQNNSQQPDPADLELLSELHSTCKAMQERVVDLIGKLAHDEMTAELLRINDELNNLF LRYSRYTKNKAVAASTILAQTIGHPQNIDSALSINKQEADSLIDLSDETDALEKKMTKIG ISDNIEKNRIDRKEKKEGDNDEFDVFAQSRNTSYETIKNSGSKYEDNLEQVSGGSLNTAI LNRNNPKYPQQTASSVASTTATSMNRESEFNEMAAWLDHTPGAHGDQESLTSSEFERFLA ERAAAAEALPTLSATTTNTGSTTNSENSNIQRQINKDQDKSLFAL |
|
| |