| Protein: 66549944 XP_393045.2 PREDICTED: microtubule-associated protein 2-like partial |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 51.2* | 31.5 | 17.3 | 2.9595375 | 1.8208092 |
| Scape | 41 | 19.8 | 39.2 | 1.0459183 | 0.50510204 |
| Brain | 38.8 | 61.2 | 0.63398695 | ||
| Crop | |||||
| Eye | |||||
| Intestine | 84.6* | 15.4 | 5.4935064 | ||
| Leg, front | 47.4 | 52.6 | 0.9011407 | ||
| Leg, middle | 22.6 | 35.9 | 41.5 | 0.5445783 | 0.86506027 |
| Leg, rear | 48.6 | 51.4 | 0.9455253 | ||
| Mandibular gland | |||||
| Rectum | |||||
| Salivary gland, cerebral | 11.2 | 88.8 | 0.12612613 | ||
| Salivary gland, thoracic | 74.8* | 5.6 | 19.6 | 3.8163266 | 0.2857143 |
| Sternite | |||||
| Tergite | |||||
| Ventriculus | |||||
| Thoracic muscle | |||||
| Fat body | |||||
| Malpighian tubules | 15.6 | 70.2* | 14.1 | 1.106383 | 4.9787235 |
| Nerve chord | 37.5 | 19.3 | 43.3 | 0.8660508 | 0.4457275 |
| Poison sac | |||||
| Sting | |||||
| Heart | |||||
| Hypopharyngeal gland | |||||
| Galea | 33.3 | 38.1 | 28.7 | 1.1602788 | 1.3275261 |
| Glossa | |||||
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 39.4 | 37.6 | 39.4 | 1 | 0.9543147 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
SPKSPTDDKRKVAEGKVKSEEEKDGDKTAAETLKCCASKSVAVKRAPTSGKQDKKSRKKS STTPEVENGSVTNESVQSNAEPTTNGVGDSPTKKSPSKTKEADKRSTAGSPVKSPSKSVK SLPRTPDTPSSTTALEKKKLPMNKIQVGSAPSPNLKTVRSKIGSLENASYKPGGGKVKIE NRKLDFSKAQPKIAAKNEKYTPSGGDKKIAQIKLQWNAKPKVGSLENATYKPGGGDKKIE TVKLDFKDKAKPKVGSKENAKHIPGGGSIK |
 Top
| |