| Protein: 328788947 XP_003251211.1 PREDICTED: hypothetical protein LOC100576916 |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 74.9* | 25.1 | 2.9840639 | ||
| Scape | |||||
| Brain | 70.1 | 29.9 | 2.3444817 | ||
| Crop | |||||
| Eye | |||||
| Intestine | |||||
| Leg, front | 36 | 21.4 | 42.6 | 0.8450704 | 0.5023474 |
| Leg, middle | 11* | 53.7 | 35.2 | 0.3125 | 1.5255681 |
| Leg, rear | 6.6 | 58.7 | 34.7 | 0.19020173 | 1.6916426 |
| Mandibular gland | 16.1 | 83.9 | 0.19189511 | ||
| Rectum | |||||
| Salivary gland, cerebral | |||||
| Salivary gland, thoracic | |||||
| Sternite | |||||
| Tergite | |||||
| Ventriculus | |||||
| Thoracic muscle | |||||
| Fat body | |||||
| Malpighian tubules | |||||
| Nerve chord | |||||
| Poison sac | |||||
| Sting | |||||
| Heart | |||||
| Hypopharyngeal gland | |||||
| Galea | 11.8* | 88.2 | 0.13378684 | ||
| Glossa | |||||
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 32.4 | 44.6 | 48.5 | 0.6680412 | 0.9195876 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MRTIIILATIFSAAIAEPGYVRSVIPYSYLEVLDTPEVAQAKAAHLATQAYEAARNTLGY AHVPALIHVYTPVSGAPLGADGNVIDTPEVAEAKAAHLTAHALETAKNLGLHPYGALAFA SLPYAYRFGYGAPIGPDGRVIDTPEVAAAKAAHLAAHEAAKLANNP |
 Top
| |