| Protein: 328778513 XP_396785.4 PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 10 mitochondrial |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 32.6 | 35.7 | 31.7 | 1.0283911 | 1.1261829 |
| Scape | 40.2 | 24.1 | 35.7 | 1.1260505 | 0.67507005 |
| Brain | 39.7 | 60.3 | 0.6583748 | ||
| Crop | 34.9 | 34.7 | 30.4 | 1.1480263 | 1.1414474 |
| Eye | 47.4 | 52.6 | 0.9011407 | ||
| Intestine | 29.1 | 31.3 | 39.6 | 0.7348485 | 0.790404 |
| Leg, front | 29.2 | 33.6 | 37.3 | 0.7828418 | 0.9008043 |
| Leg, middle | 45.4 | 23.9 | 30.7 | 1.4788274 | 0.77850163 |
| Leg, rear | 16.4 | 28.4 | 55.2 | 0.29710144 | 0.51449275 |
| Mandibular gland | 88.2* | 11.8 | 7.4745765 | ||
| Rectum | 55.4 | 14.3 | 30.3 | 1.8283828 | 0.4719472 |
| Salivary gland, cerebral | 14.3 | 23.6 | 62.1 | 0.23027375 | 0.3800322 |
| Salivary gland, thoracic | 28.8 | 44.3 | 26.9 | 1.070632 | 1.6468401 |
| Sternite | 34.8 | 20.2 | 45 | 0.7733333 | 0.4488889 |
| Tergite | 43.7 | 32.1 | 24.2 | 1.8057852 | 1.3264463 |
| Ventriculus | |||||
| Thoracic muscle | 19.7 | 64.9 | 15.4 | 1.2792208 | 4.214286 |
| Fat body | 35.4 | 37.1 | 27.5 | 1.2872727 | 1.3490909 |
| Malpighian tubules | 33.1 | 36.8 | 30.1 | 1.0996678 | 1.2225914 |
| Nerve chord | 25.7 | 38.1 | 36.2 | 0.7099447 | 1.0524862 |
| Poison sac | |||||
| Sting | 26.4 | 73.6 | 0.35869566 | ||
| Heart | 43.3 | 22.7 | 34 | 1.2735294 | 0.66764706 |
| Hypopharyngeal gland | 81.1 | 18.9 | 4.291005 | ||
| Galea | 48.6 | 21.5 | 29.9 | 1.6254181 | 0.7190635 |
| Glossa | 56.4 | 23.3 | 20.4 | 2.764706 | 1.1421568 |
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 37.8 | 34.1 | 35.8 | 1.0558659 | 0.952514 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MTSIFSVRIAKSNSIEYLTRLCKISKNYNITQVAFIKRIAFKEHIPKPAPYPYWKKVCNE ITMILDPTSLRYDDNTKLIVVDGPPAVGKTKLCEQIAKDFGFLYMPAPTHDEIFINYYGF DIRDLNPQLPESCRFYDLKDFLRNPYYYRTASIQLGFFNMRFEQYMNALVHILATGQGVV LNRSIFTEYAFMDAMHKAGYLSDLTVKEFEMMRKNSFKFLLRPHLVIYLDASPEIIQEKI KKRGNVDEINSKVFTTKFLTDLENATKEKCLSWLSSHSHILIYDWSKEGNNIDVIQDIET LDFEEDQYKEKLQDWVFVDTDQLINFLERYQNKTYIFDYMNRKTEPIIATDMYLINDERD IQQKVLETVNSEKYQPGCNPYYDKIPWITKKQSPLFCIYRRTPRDFVNCDLFKFI |
 Top
| |