| Protein: 48142774 XP_393613.1 PREDICTED: PRA1 family protein 3-like isoform 2 |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | |||||
| Scape | 28.9 | 23.4 | 47.7 | 0.60587 | 0.49056605 |
| Brain | |||||
| Crop | 37.3 | 36.7 | 25.9 | 1.4401544 | 1.4169884 |
| Eye | |||||
| Intestine | 63 | 37 | 1.7027028 | ||
| Leg, front | 62.5 | 37.5 | 1.6666666 | ||
| Leg, middle | 57.8 | 42.2 | 1.3696682 | ||
| Leg, rear | |||||
| Mandibular gland | |||||
| Rectum | |||||
| Salivary gland, cerebral | |||||
| Salivary gland, thoracic | 34.6 | 30.3 | 35.1 | 0.98575497 | 0.8632479 |
| Sternite | 45.6 | 20 | 34.4 | 1.3255814 | 0.5813953 |
| Tergite | 66.3 | 33.7 | 1.9673591 | ||
| Ventriculus | |||||
| Thoracic muscle | 52.8 | 47.2 | 1.1186441 | ||
| Fat body | 28.8 | 27.6 | 43.6 | 0.6605505 | 0.6330275 |
| Malpighian tubules | 45.9 | 54.1 | 0.84842885 | ||
| Nerve chord | 18.4 | 57.6 | 24 | 0.76666665 | 2.4 |
| Poison sac | |||||
| Sting | |||||
| Heart | 21.9 | 40.8 | 37.3 | 0.5871314 | 1.0938338 |
| Hypopharyngeal gland | 54.9 | 45.1 | 1.2172949 | ||
| Galea | 30.7 | 33.5 | 35.8 | 0.8575419 | 0.9357542 |
| Glossa | 36.1 | 23.4 | 40.5 | 0.891358 | 0.5777778 |
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 36.5 | 41.2 | 38.8 | 0.94072163 | 1.0618557 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MDKTISIADGWELPPLRSLYDFLLESSRFQLPNFRDLEKWGNRVANNLVYYQTNYLYMCI AIILVVASVHPVKMIVGITAAMAIWGECIYLFSEKESLLKFKRTYPQVGVILTIICGSFV IYTINSVLFVLFGILLSFCVIFIHASLRLRNVKNKLANKIEGMGLKRTPMGVILNYFGMK EEFFT |
 Top
| |