| Protein: 328785406 XP_003250598.1 PREDICTED: sepiapterin reductase-like |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 67.4* | 32.6 | 2.0674846 | ||
| Scape | |||||
| Brain | |||||
| Crop | |||||
| Eye | |||||
| Intestine | |||||
| Leg, front | 59.2* | 25 | 15.7 | 3.7707007 | 1.5923567 |
| Leg, middle | 63.6* | 22.9 | 13.5 | 4.711111 | 1.6962963 |
| Leg, rear | 78.4 | 12.2 | 9.4 | 8.3404255 | 1.2978723 |
| Mandibular gland | 25.5 | 74.5 | 0.34228188 | ||
| Rectum | |||||
| Salivary gland, cerebral | |||||
| Salivary gland, thoracic | 8.9 | 69.4 | 21.7 | 0.41013825 | 3.1981566 |
| Sternite | |||||
| Tergite | |||||
| Ventriculus | |||||
| Thoracic muscle | |||||
| Fat body | 27.7 | 13.2 | 59.1 | 0.46869713 | 0.22335026 |
| Malpighian tubules | |||||
| Nerve chord | |||||
| Poison sac | |||||
| Sting | |||||
| Heart | 6.1 | 62 | 31.9 | 0.19122258 | 1.9435737 |
| Hypopharyngeal gland | |||||
| Galea | |||||
| Glossa | |||||
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 42.1 | 34.1 | 32.3 | 1.3034055 | 1.0557276 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MSVKILSGKVFLVITGASRGIGRQLAISFGSILEKGSHILLLATNLNALKETAKNIPPSI FVDTVSIDLAKATKDKLYDIIIQSLKNEILDQFDHVVVIHNVGSIGNINQYANDLTELNV WHDYYDLNVFIPAILNGVIMKIFNKNTNTKKLVINITSLLGIKPEKSMAYYCSGKAAREM FFKVFALENPQVNVLNYSPGPVETDMYHEVCTKIADEEVKTQFNDLLTKKTILTCEKTVN RLLTILEEQKYKSGDHVDYYDEL |
 Top
| |