| Protein: 66508961 XP_395902.2 PREDICTED: flavin reductase-like |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 40.3 | 29.5 | 30.2 | 1.3344371 | 0.9768212 |
| Scape | |||||
| Brain | |||||
| Crop | |||||
| Eye | |||||
| Intestine | 41.6 | 23.7 | 34.8 | 1.1954023 | 0.6810345 |
| Leg, front | 53 | 47 | 1.1276596 | ||
| Leg, middle | 45.9 | 54.1 | 0.84842885 | ||
| Leg, rear | 62.6 | 12.7 | 24.7 | 2.5344129 | 0.51417005 |
| Mandibular gland | |||||
| Rectum | |||||
| Salivary gland, cerebral | |||||
| Salivary gland, thoracic | 30.4 | 8.7 | 60.8 | 0.5 | 0.14309211 |
| Sternite | |||||
| Tergite | |||||
| Ventriculus | |||||
| Thoracic muscle | |||||
| Fat body | 16.2 | 16.5 | 67.4 | 0.24035609 | 0.24480712 |
| Malpighian tubules | 35.8 | 39.7 | 24.5 | 1.4612244 | 1.6204082 |
| Nerve chord | 62.1 | 37.9 | 1.6385224 | ||
| Poison sac | |||||
| Sting | |||||
| Heart | 1.9 | 51.1 | 47.1 | 0.040339705 | 1.0849257 |
| Hypopharyngeal gland | |||||
| Galea | |||||
| Glossa | |||||
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 36.4 | 30.5 | 42.8 | 0.85046726 | 0.7126168 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MNRIVIFGATGNTGLCALNSAVNKGLNIKVFVRDENKVPMNLKNKIEIIIGDVTNKEQVS NAISNTDAVVVVLGTRNDLSPTTILSTGMKNIIDAMKMHSVEVVSVCLSAFLFYKPETVP NIFKDLNADHQRMFDLLKESQLKWIAVLPPHIADVPNSKYIVKYNESPGRAISKHDLGAF LIESLQQTEHYQKVCGIANTA |
 Top
| |