| Protein: 328785201 XP_003250559.1 PREDICTED: multiple inositol polyphosphate phosphatase 1-like |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 30.4 | 30.6 | 39 | 0.7794872 | 0.7846154 |
| Scape | 48.3 | 24.2 | 27.5 | 1.7563636 | 0.88 |
| Brain | 32.8 | 67.2 | 0.48809522 | ||
| Crop | 46.1 | 25.4 | 28.4 | 1.6232394 | 0.8943662 |
| Eye | |||||
| Intestine | 11.9 | 56 | 32.1 | 0.3707165 | 1.7445483 |
| Leg, front | 34.6 | 27.2 | 38.3 | 0.9033943 | 0.7101828 |
| Leg, middle | 35.6 | 27.5 | 37 | 0.96216214 | 0.7432432 |
| Leg, rear | 22.8 | 25.8 | 51.5 | 0.44271845 | 0.5009709 |
| Mandibular gland | 18.1 | 81.9 | 0.22100122 | ||
| Rectum | 45.7 | 54.3 | 0.8416206 | ||
| Salivary gland, cerebral | 10.8 | 27.4 | 61.8 | 0.17475729 | 0.4433657 |
| Salivary gland, thoracic | 40.9 | 24.7 | 34.4 | 1.1889535 | 0.71802324 |
| Sternite | 22.3 | 27.4 | 50.2 | 0.4442231 | 0.5458167 |
| Tergite | 36.1 | 63.9 | 0.5649452 | ||
| Ventriculus | |||||
| Thoracic muscle | |||||
| Fat body | 65.9 | 14.4 | 19.7 | 3.3451777 | 0.7309645 |
| Malpighian tubules | 44.3 | 39.6 | 16.2 | 2.7345679 | 2.4444444 |
| Nerve chord | 31.8 | 35.1 | 33 | 0.96363634 | 1.0636364 |
| Poison sac | |||||
| Sting | 52.8 | 47.2 | 1.1186441 | ||
| Heart | 9.1 | 18.1* | 72.7 | 0.12517194 | 0.24896836 |
| Hypopharyngeal gland | 85.7 | 14.3 | 5.993007 | ||
| Galea | 40.6 | 26.2 | 33.2 | 1.2228916 | 0.7891566 |
| Glossa | 44.3 | 23.2 | 32.4 | 1.3672839 | 0.7160494 |
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 33 | 33.5 | 42.6 | 0.7746479 | 0.786385 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MNAYVLFLTLLISHVYARDVDYCFKEENDPYLYMATKTAYHFVYHKGRFQDVPNCQAKQI WMLVTHGTRCSSKSEIMEMLKLKDFQKEIINNHELRNNGHLCNKDLENLKKWNPNEYLMI ERAKVLAPQGVEDMRLLARRLQSSFPHLLQPNNNENITERDYVFKESDAYNSMGAFMEGL FKSRDVVDSEKVPENDTLLTMYKMCDSWDNEYNNVSYEEVIAFEESEDFRNLVENVSRRL GFLYIPKDSILTMYDMCRYEKAWTVTQLSPWCAVFSKEELHVLEYREDLYYYYKAGYGRE INARLGCTLLQDMMNHFWKMEQEDESNQPKGVFYFSDTISLLNLLTTLNINKDQMQLKAF NYKEMAKRQWRTSFMSSFAANLIAVFYKCDTISQPNKVMFYLAEKLVMIDGCDVGLCDWE YIKQKFNPVLKQCDMKTCWNENGVPIFLPNFVLLILSCFSLIFIRE |
 Top
| |