| Protein: 328793432 XP_623502.3 PREDICTED: probable pyruvate dehydrogenase E1 component subunit alpha mitochondrial-like isoform 1 |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 33.8 | 30.4 | 35.9 | 0.9415042 | 0.84679663 |
| Scape | 33.8 | 27.9 | 38.3 | 0.88250655 | 0.72845954 |
| Brain | 55.3 | 44.7 | 1.2371365 | ||
| Crop | 28.3 | 31.7 | 40 | 0.7075 | 0.7925 |
| Eye | 27.9 | 38.7 | 33.5 | 0.8328358 | 1.1552238 |
| Intestine | 38.2 | 20.3 | 41.6 | 0.9182692 | 0.48798078 |
| Leg, front | 36.1 | 30 | 33.8 | 1.0680473 | 0.88757396 |
| Leg, middle | 27.6 | 36.9 | 35.4 | 0.779661 | 1.0423728 |
| Leg, rear | 30.2 | 30.9 | 38.9 | 0.7763496 | 0.7943445 |
| Mandibular gland | 64.8 | 35.2 | 1.8409091 | ||
| Rectum | 26.3 | 73.7 | 0.3568521 | ||
| Salivary gland, cerebral | 39 | 31.7 | 29.3 | 1.331058 | 1.0819112 |
| Salivary gland, thoracic | 31.6 | 40.3 | 28.1 | 1.1245551 | 1.4341637 |
| Sternite | 36.8 | 30.7 | 32.5 | 1.1323076 | 0.94461536 |
| Tergite | 32.8 | 34 | 33.2 | 0.9879518 | 1.0240964 |
| Ventriculus | |||||
| Thoracic muscle | 20.7 | 55.3 | 24 | 0.8625 | 2.3041666 |
| Fat body | 25.8 | 44.2 | 30 | 0.86 | 1.4733334 |
| Malpighian tubules | 38.4 | 28.4 | 33.2 | 1.1566265 | 0.85542166 |
| Nerve chord | 33.9 | 20.8 | 45.3 | 0.74834436 | 0.45916116 |
| Poison sac | |||||
| Sting | 59.9 | 40.1 | 1.4937656 | ||
| Heart | 42.2 | 23 | 34.8 | 1.2126436 | 0.66091955 |
| Hypopharyngeal gland | 93.9 | 6.1 | 15.393442 | ||
| Galea | 24.9 | 47.6 | 27.5 | 0.9054545 | 1.7309091 |
| Glossa | 17.1 | 56.2 | 26.6 | 0.64285713 | 2.112782 |
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 32.9 | 39.5 | 35.1 | 0.93732196 | 1.1253561 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MRIFNHNMVISYFFNKKNNYATEASFETKPFRLHKLDNGPSTQITVTKDEAIELYKKLHT IRRMETAAGNLYKEKIVRGFCHLYSGQEACAVGIKAALRPQDCVITAYRAHGWTYLMGIE PFGVLAELTGKKGGNAKGKGGSMHMYSDNFYGGNGIVGAQVPLGVGIAFAHKYNNTGGVC VTLYGDGAANQGQVFEVYNMAKLWDVPCIFVCENNGYGMGTSVDRASASTDYYTRGDYIP GIWVDGMDVLAVKQATKFAIDYCTSGKGPIVLETVTYRYSGHSMSDPGTSYRTREEIQEV RQTRDPITGFKERILNANLITPEEIKTIENEIRKQVDDAVKAAKTDTEIPLNELTADIYA NCVEKEIRNITPFNPLPHTRLGPAVNS |
 Top
| |