| Protein: 328779857 XP_392350.3 PREDICTED: hexokinase-2-like |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 69.2* | 30.8 | 2.2467532 | ||
| Scape | 46.1 | 20.5 | 33.3 | 1.3843844 | 0.6156156 |
| Brain | |||||
| Crop | |||||
| Eye | |||||
| Intestine | |||||
| Leg, front | 89.3* | 10.7 | 8.345795 | ||
| Leg, middle | |||||
| Leg, rear | 86.6 | 13.4 | 6.4626865 | ||
| Mandibular gland | |||||
| Rectum | |||||
| Salivary gland, cerebral | |||||
| Salivary gland, thoracic | 18.1 | 50.2 | 31.7 | 0.5709779 | 1.5835962 |
| Sternite | |||||
| Tergite | |||||
| Ventriculus | |||||
| Thoracic muscle | |||||
| Fat body | 9.5 | 31.1 | 59.4 | 0.15993266 | 0.52356905 |
| Malpighian tubules | 15.4* | 47.2 | 37.4 | 0.4117647 | 1.262032 |
| Nerve chord | 10 | 80.1* | 9.9 | 1.010101 | 8.090909 |
| Poison sac | |||||
| Sting | 41.4 | 58.6 | 0.7064846 | ||
| Heart | 1.2 | 64.9 | 33.8 | 0.03550296 | 1.9201183 |
| Hypopharyngeal gland | |||||
| Galea | |||||
| Glossa | |||||
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 32 | 53.1 | 31.9 | 1.0031348 | 1.6645768 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MSLVRIEQKLARLQFSTTVVKNIQDVFESEMNKGIHQQPSSLQMENTYVPELLDGTEKGL YLALDLGGTNFRVLLLELDHGIPKREEVKKYHISSDLRVGSGIRLFDYLAECVSDFVIAQ GLQDVELPLGFTFSFPMIQHSLDIGILVTWTKTFNCPDVVNEDAVKLLREALDRRGDTKV KVVAILNDTTGTLVQGSTLDPDTAIGLILGTGSNACYIERADRVEHWETERHGERQVIID IEWGAFGDNGVLDFIKTDFDRENDANSLIVNSFTFEKYISGKYLGEIVRVVLAKLYKDGL LFIGDHTPGSLLVPGNLTSDLVSDIEQDSVDGDYNSTKEVLMKFGIIPDEDDVKIVQYVC EVVSNRAALLVSICLAVLLKRIDRKHVTIAVDGSLYKHHPRLETWIKQYIPLLAPDHKFK MIHAEDGSGKGAALVAAIAQRLQNRLD |
 Top
| |