| Protein: 328781744 XP_395359.4 PREDICTED: v-type proton ATPase subunit C |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 30.6 | 32 | 37.4 | 0.8181818 | 0.85561496 |
| Scape | 27.5 | 35 | 37.6 | 0.73138297 | 0.93085104 |
| Brain | 45.6 | 24.5 | 29.9 | 1.5250837 | 0.819398 |
| Crop | 73.1 | 26.9 | 2.717472 | ||
| Eye | |||||
| Intestine | 35.1 | 25.6 | 39.3 | 0.89312977 | 0.6513995 |
| Leg, front | 40.4 | 26.7 | 32.9 | 1.2279636 | 0.81155014 |
| Leg, middle | 35.5 | 29.3 | 35.2 | 1.0085227 | 0.8323864 |
| Leg, rear | 26.5 | 35.1 | 38.4 | 0.6901042 | 0.9140625 |
| Mandibular gland | |||||
| Rectum | 23.8 | 45 | 31.2 | 0.76282054 | 1.4423077 |
| Salivary gland, cerebral | |||||
| Salivary gland, thoracic | 55.4 | 5.8* | 38.8 | 1.4278351 | 0.14948453 |
| Sternite | |||||
| Tergite | |||||
| Ventriculus | 31.7 | 4.8* | 63.5 | 0.4992126 | 0.07559055 |
| Thoracic muscle | |||||
| Fat body | 66.3 | 33.7 | 1.9673591 | ||
| Malpighian tubules | 33.4 | 35 | 31.6 | 1.056962 | 1.107595 |
| Nerve chord | 18.7 | 50.4 | 31 | 0.6032258 | 1.6258065 |
| Poison sac | |||||
| Sting | |||||
| Heart | 33.6 | 29.8 | 36.6 | 0.91803277 | 0.8142077 |
| Hypopharyngeal gland | |||||
| Galea | |||||
| Glossa | |||||
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 38.5 | 29.2 | 36.3 | 1.060606 | 0.8044077 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MFKSSSQTSVDGESSSPEGGPDTPPNTPVTPSHKSSKEHHKQWKESEKCEPEPAACLGQH HYQRHHHHEHHHSHKHHNHPSDVEKKSSHSPQGICDVRSSNDPLSAYSCYHAHWCAASTS STPIPSPTPTSPSLSLSSNCSSEGETRWQSATRHRTTEKADRSTSNRKSLGNDDDEDDVD QNNDQDQDQDHSGNLPNPGDLPSYITRFQWDMAKYPIKQSLRNIADIISKQVGQIDADLK TKSTTYNNLKGSLQNLEKKQTGSLLTRNLADLVKKEHFILDSEYLTTLLVIVPRANFQDW YSGYEKLTKMVVPRTTQLITQDSEYGLFTVTLFKKVIEEFKLHAREKKFIVRDFTYNEEE LAAGKNEITKLVTDKKKQFGPLVRWLKVNFSECFCAWIHVKALRVFVESVLRYGLPVNFQ AILLHPHRKCARRLRDVLNQHYAHLDSSATASSAAQGTQDSVDIPGLGFGQNDYFPYVYY KINVDMVDNKV |
 Top
| |