| Protein: 48094957 XP_394313.1 PREDICTED: microsomal glutathione S-transferase 1 isoform 1 |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 27.7 | 40 | 32.4 | 0.85493827 | 1.2345679 |
| Scape | 31.4 | 68.6 | 0.45772594 | ||
| Brain | 31.5 | 11.8 | 56.7 | 0.5555556 | 0.20811288 |
| Crop | 56.8 | 6.3 | 36.9 | 1.5392954 | 0.17073171 |
| Eye | |||||
| Intestine | 22.3 | 56.2 | 21.6 | 1.0324074 | 2.601852 |
| Leg, front | 31 | 35.5 | 33.5 | 0.92537314 | 1.0597014 |
| Leg, middle | 42.8 | 24.9 | 32.3 | 1.3250774 | 0.7708978 |
| Leg, rear | 59.7 | 22.6 | 17.7 | 3.3728814 | 1.2768362 |
| Mandibular gland | 9.7 | 58.9 | 31.4 | 0.3089172 | 1.8757962 |
| Rectum | 25.7 | 47.8 | 26.5 | 0.9698113 | 1.8037736 |
| Salivary gland, cerebral | 93.2 | 6.8 | 13.705882 | ||
| Salivary gland, thoracic | 30.9 | 31.8 | 37.3 | 0.82841825 | 0.85254693 |
| Sternite | 14 | 16.3 | 69.7 | 0.20086083 | 0.23385939 |
| Tergite | 13.7 | 32.2 | 54.1 | 0.25323474 | 0.5951941 |
| Ventriculus | 16.1 | 44.9 | 39 | 0.41282052 | 1.1512821 |
| Thoracic muscle | |||||
| Fat body | 4.5* | 17.3 | 78.2 | 0.057544757 | 0.22122762 |
| Malpighian tubules | 36.2 | 36.4 | 27.4 | 1.3211678 | 1.3284671 |
| Nerve chord | 40.2 | 59.8 | 0.6722408 | ||
| Poison sac | |||||
| Sting | |||||
| Heart | 5.8 | 46.2 | 48 | 0.12083333 | 0.9625 |
| Hypopharyngeal gland | 15 | 85 | 0.1764706 | ||
| Galea | 31.5 | 23.9 | 44.6 | 0.706278 | 0.5358744 |
| Glossa | 33.1 | 36.6 | 30.3 | 1.0924093 | 1.2079208 |
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 31.3 | 31.8 | 42.6 | 0.7347418 | 0.74647886 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MSLNTSLIGTEIFKIFAFWGTILALKLIAMVPLTAYYRFKNKTFSNPEDAITLKGAKVAT NDPEIERVRRAHLNDLENILIWYIVTFVWLTTNPSVWLASLLIRSFVIARILHTLVYAIF AKQPHRAIVFFIGYATTLYQAANTLLFYM |
 Top
| |