| Protein: 328776656 XP_394113.3 PREDICTED: CDGSH iron-sulfur domain-containing protein 2 homolog |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 37.7 | 31.7 | 30.6 | 1.2320261 | 1.0359477 |
| Scape | 44.9 | 28.1 | 27 | 1.6629629 | 1.0407407 |
| Brain | 34 | 30.7 | 35.3 | 0.9631728 | 0.8696884 |
| Crop | 36.8 | 38.5 | 24.8 | 1.483871 | 1.5524193 |
| Eye | 39.5 | 60.5 | 0.6528926 | ||
| Intestine | 37.2 | 23.9 | 38.9 | 0.9562982 | 0.6143959 |
| Leg, front | 22.3 | 41 | 36.6 | 0.60928965 | 1.1202186 |
| Leg, middle | 31.7 | 35.8 | 32.5 | 0.9753846 | 1.1015384 |
| Leg, rear | 27.6 | 38 | 34.4 | 0.8023256 | 1.1046512 |
| Mandibular gland | 45.6 | 12.7 | 41.7 | 1.0935252 | 0.30455637 |
| Rectum | 8.3 | 65.2 | 26.4 | 0.31439394 | 2.469697 |
| Salivary gland, cerebral | 63.2 | 21.3 | 15.6 | 4.051282 | 1.3653846 |
| Salivary gland, thoracic | 39.6 | 28.4 | 32 | 1.2375 | 0.8875 |
| Sternite | 28.2 | 35.9 | 35.9 | 0.7855153 | 1 |
| Tergite | 22.8 | 44.1 | 33.1 | 0.68882173 | 1.3323263 |
| Ventriculus | 30.7 | 34.3 | 35.1 | 0.87464386 | 0.97720796 |
| Thoracic muscle | 38.8 | 61.2 | 0.63398695 | ||
| Fat body | 26.8 | 34.3 | 39 | 0.6871795 | 0.87948716 |
| Malpighian tubules | 32.4 | 40.3 | 27.3 | 1.1868132 | 1.4761904 |
| Nerve chord | 24.7 | 48.1 | 27.2 | 0.9080882 | 1.7683823 |
| Poison sac | |||||
| Sting | 44.7 | 55.3 | 0.80831826 | ||
| Heart | 30.4 | 33 | 36.7 | 0.82833785 | 0.89918256 |
| Hypopharyngeal gland | 86.3 | 13.7 | 6.29927 | ||
| Galea | 57.1* | 21.3 | 21.6 | 2.6435184 | 0.9861111 |
| Glossa | 34.8 | 21 | 44.2 | 0.7873303 | 0.47511312 |
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 34.3 | 36.6 | 34.7 | 0.98847264 | 1.0547551 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MMPIAHLVKVTLPNYLAGLPIPDSIGGWFRLGIRDWIALIPPTALVAGIGYMSYKAFCPL ARPPCGLVNLSVKKDVNKVVDSVDIEDITEKAAFCRCWRSKNWPYCDGAHGRHNEEMNDN VGPLVITRKKD |
 Top
| |