| Protein: 328785872 XP_003250667.1 PREDICTED: chitotriosidase-1-like |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | |||||
| Scape | 53.2 | 46.8 | 1.1367521 | ||
| Brain | |||||
| Crop | 13.7 | 86.3 | 0.15874855 | ||
| Eye | |||||
| Intestine | 82.6* | 1.3* | 16 | 5.1625 | 0.08125 |
| Leg, front | |||||
| Leg, middle | |||||
| Leg, rear | |||||
| Mandibular gland | 46.3 | 53.7 | 0.8621974 | ||
| Rectum | 19.4 | 1.9 | 78.7 | 0.24650572 | 0.024142314 |
| Salivary gland, cerebral | |||||
| Salivary gland, thoracic | 53.2 | 46.8 | 1.1367521 | ||
| Sternite | |||||
| Tergite | 2.1 | 97.9 | 0.02145046 | ||
| Ventriculus | 38.6 | 50.5 | 10.9 | 3.5412843 | 4.6330276 |
| Thoracic muscle | |||||
| Fat body | 91.1 | 1* | 8 | 11.3875 | 0.125 |
| Malpighian tubules | 1.6* | 46.4 | 51.9 | 0.030828517 | 0.894027 |
| Nerve chord | 1.8* | 43.3 | 54.9 | 0.032786883 | 0.7887067 |
| Poison sac | |||||
| Sting | 38.3 | 61.7 | 0.62074554 | ||
| Heart | 5.6 | 75.1* | 19.3 | 0.29015544 | 3.8911917 |
| Hypopharyngeal gland | |||||
| Galea | |||||
| Glossa | |||||
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 34.2 | 32.5 | 48.7 | 0.7022587 | 0.6673511 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MRQILRIGFLITFLAYAVTSIVADNKIICYYGSWATYRPGIGQFNPTDIDPKLCTHIVYT FVGIYTDGRVYVLDSWNDLPSGKNGFGKFTSLRQLNPNVTVLVGMGGWNEGSYKYSQVAG NPAVRAKFVQNMVAFLKMYNFDGLDLDWSFPNQRGGVVADRENYITLLKELRQEFDKNGY NLSVTVSAPEYSASASYIIPEIIKYVDYISLMTYDLHGTWEKVALLHSGLYPSGKDTDIR LDTNVDWCVKYWLTQGASVDKIILGIPAHGRSFTLSNSTNNQPGAPILGVGNPGPYSQEG GILAYNEICEFIKLGWTVERDSKQRVPYAYQNNQWVGYDDVTSVEEKVNYAKSKGLAGVM LWGIENDDFRGLYGEKYPLLNAINKAYKEN |
 Top
| |