| Protein: 328791545 XP_001120572.2 PREDICTED: bis(5'-nucleosyl)-tetraphosphatase [asymmetrical] |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 26.7 | 48 | 25.2 | 1.0595238 | 1.9047619 |
| Scape | 31.8 | 32.8 | 35.4 | 0.89830506 | 0.92655367 |
| Brain | |||||
| Crop | |||||
| Eye | |||||
| Intestine | 46.3 | 53.7 | 0.8621974 | ||
| Leg, front | |||||
| Leg, middle | |||||
| Leg, rear | |||||
| Mandibular gland | |||||
| Rectum | |||||
| Salivary gland, cerebral | |||||
| Salivary gland, thoracic | 53.4 | 6.6 | 40 | 1.335 | 0.165 |
| Sternite | |||||
| Tergite | |||||
| Ventriculus | |||||
| Thoracic muscle | |||||
| Fat body | |||||
| Malpighian tubules | 60.8 | 39.2 | 1.5510204 | ||
| Nerve chord | 88.1* | 11.9 | 7.4033613 | ||
| Poison sac | |||||
| Sting | |||||
| Heart | |||||
| Hypopharyngeal gland | |||||
| Galea | |||||
| Glossa | |||||
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 39.6 | 47.3 | 34.2 | 1.1578947 | 1.3830409 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MMTTRACGFVIFRRIQGMVEYLLMQVSYGEHHWTPPKGHVDPGESDMESALRETQEEAGF LASDLIIFEDAKQELNYEVNGKPKTVVYWLAELVNIDKPIQLSHEHQAFKWLPLQEACSI AKYQDMQNVLKNFNEYILKNLS |
 Top
| |