| Protein: 328785226 XP_001121998.2 PREDICTED: flotillin-2 |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 35.3 | 64.7 | 0.54559505 | ||
| Scape | 54 | 10.9 | 35.1 | 1.5384616 | 0.3105413 |
| Brain | |||||
| Crop | |||||
| Eye | |||||
| Intestine | 16.7 | 38.1 | 45.3 | 0.36865342 | 0.8410596 |
| Leg, front | 82.3* | 17.7 | 4.6497173 | ||
| Leg, middle | 48.5 | 51.5 | 0.94174755 | ||
| Leg, rear | 59.2 | 40.8 | 1.4509804 | ||
| Mandibular gland | |||||
| Rectum | |||||
| Salivary gland, cerebral | |||||
| Salivary gland, thoracic | 58.7 | 41.3 | 1.4213076 | ||
| Sternite | |||||
| Tergite | |||||
| Ventriculus | |||||
| Thoracic muscle | |||||
| Fat body | 62.7 | 11 | 26.3 | 2.3840303 | 0.41825095 |
| Malpighian tubules | |||||
| Nerve chord | 18.1 | 40.7 | 41.2 | 0.4393204 | 0.9878641 |
| Poison sac | |||||
| Sting | |||||
| Heart | |||||
| Hypopharyngeal gland | |||||
| Galea | |||||
| Glossa | |||||
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 46.9 | 34.6 | 40.4 | 1.160891 | 0.85643566 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MKKRTIVGGYAFTWWFVTDVQRLSLEVMTLNPVCESVETAQGVPLTVTGVAQCKIMKADE LLHTASEQFLGKSVYEIKSTILSTLEGHLRAILGTLSVEEVYKDRDQFATLVREVAAPDV GRMGIEILSFTIKDVYDDVQYLASLGKAQTAAVKRDADVGVAEANRDAGIREAECEKAAM DIKYNTDTKIEDNARLFQLQKANFDQEVNTAKAEAQLAYELQAAKIRQRIRNEEIQIEVV ERRKQIEVEEQEVRRKEHELQSTVRLPAEAEHYKIGKVAEGKRTQTVNAAIAEAERIRLI GTAEAQALEAIGVSEAQRMQMKAAVYKKYGGAAILNIALNALPKIAAEVAAPLARTEEIV LLGGNDATSGEITRLVGQVPPAVQALTGVDISKVLGKIPGAK |
 Top
| |