| Protein: 48096057 XP_392390.1 PREDICTED: pyrroline-5-carboxylate reductase 2-like |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 37 | 13.4* | 49.6 | 0.74596775 | 0.2701613 |
| Scape | |||||
| Brain | 42.7 | 57.3 | 0.7452007 | ||
| Crop | 3.6* | 96.4 | 0.0373444 | ||
| Eye | |||||
| Intestine | 75.3* | 24.7 | 3.048583 | ||
| Leg, front | |||||
| Leg, middle | 35 | 4* | 61 | 0.57377046 | 0.06557377 |
| Leg, rear | 97* | 3 | 32.333332 | ||
| Mandibular gland | |||||
| Rectum | |||||
| Salivary gland, cerebral | |||||
| Salivary gland, thoracic | 0.8* | 88.4* | 10.8 | 0.074074075 | 8.185185 |
| Sternite | |||||
| Tergite | |||||
| Ventriculus | |||||
| Thoracic muscle | |||||
| Fat body | 5.8 | 53.4 | 40.7 | 0.14250614 | 1.3120393 |
| Malpighian tubules | 16.8* | 10.1* | 73.1 | 0.22982216 | 0.13816689 |
| Nerve chord | |||||
| Poison sac | |||||
| Sting | |||||
| Heart | 0.9* | 62.8 | 36.3 | 0.024793388 | 1.7300276 |
| Hypopharyngeal gland | |||||
| Galea | |||||
| Glossa | |||||
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 33.6 | 34.8 | 45.3 | 0.74172187 | 0.7682119 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MTTGLKTMEFLRLGRRVRRRLNARSVSDQLLGDGEEKKKRVTLNIDTKMLKIGFIGGGKM AQALARGFIRSGLSKGEMMLASCLPNDMSSIDAFKEIGSNTVFSNQPVIDHGDVLILSVK PQVVPKVLPELKNYKKLLLSIAMGIPLASLEKALPDGTPVIRVMPNTPVLVGCGATVYAR GKYAGDKEAEIAEKLFSSVGLCEEVPENLIDPVTGLAGSGPAYVYMMIEALADGGVKMGL MRPFAYKLAVQTVLGAGTMVRDTKTHPGQLKDDVASPAGSTIVALHYLEEHGLRSAIIGA VEVSTKRCKEVSLNAEKK |
 Top
| |