| Protein: 295849286 NP_001171519.1 superoxide dismutase 2 mitochondrial |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 41.3 | 28.9 | 29.9 | 1.3812709 | 0.9665552 |
| Scape | 32.5 | 33.3 | 34.2 | 0.9502924 | 0.9736842 |
| Brain | 45.7 | 54.3 | 0.8416206 | ||
| Crop | 28.9 | 28.3 | 42.8 | 0.67523366 | 0.66121495 |
| Eye | 17.2 | 39.3 | 43.5 | 0.3954023 | 0.9034483 |
| Intestine | 21.3 | 27.7 | 51 | 0.41764706 | 0.54313725 |
| Leg, front | 35.1 | 30.4 | 34.5 | 1.0173913 | 0.8811594 |
| Leg, middle | 35 | 29.4 | 35.6 | 0.9831461 | 0.8258427 |
| Leg, rear | 39.8 | 22.5 | 37.7 | 1.0557029 | 0.59681696 |
| Mandibular gland | 20.3 | 24.8 | 55 | 0.3690909 | 0.45090908 |
| Rectum | 25.6 | 18.6 | 55.8 | 0.45878136 | 0.33333334 |
| Salivary gland, cerebral | 63.1 | 16.6 | 20.3 | 3.1083744 | 0.817734 |
| Salivary gland, thoracic | 23.6 | 50.1 | 26.4 | 0.8939394 | 1.8977273 |
| Sternite | 45.6 | 32.6 | 21.8 | 2.0917432 | 1.4954128 |
| Tergite | 24.8 | 38.5 | 36.7 | 0.6757493 | 1.0490463 |
| Ventriculus | 75.1 | 12.9 | 12.1 | 6.2066116 | 1.0661157 |
| Thoracic muscle | 5.9 | 55.1 | 39.1 | 0.15089513 | 1.4092071 |
| Fat body | 32.2 | 30.5 | 37.3 | 0.86327076 | 0.81769437 |
| Malpighian tubules | 40.9 | 28.8 | 30.3 | 1.349835 | 0.95049506 |
| Nerve chord | 28.8 | 28.8 | 42.4 | 0.6792453 | 0.6792453 |
| Poison sac | |||||
| Sting | 44.7 | 55.3 | 0.80831826 | ||
| Heart | 48.7 | 16.3 | 34.9 | 1.3954154 | 0.4670487 |
| Hypopharyngeal gland | 89.6 | 10.4 | 8.615385 | ||
| Galea | 41.6 | 25.3 | 33.1 | 1.2567976 | 0.7643505 |
| Glossa | 35 | 20.9 | 44.1 | 0.7936508 | 0.4739229 |
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 34.6 | 32.8 | 36.7 | 0.9427793 | 0.89373296 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MFAARRILFSNTVKDTFTRTKHTLPDLPYDYKALEPIISAEIMQLHHSKHHATYVNNLNV AEEKMKEAVAKGDVNTQVALSPAIKFNGGGHLNHSIFWCNLSPNGGKPDAALLNQIKKDF GSIEEMKKRLSENTIAIQGSGWGWLGYCQKSKSLRIATCANQDPLQATTGLIPLFGIDVW EHAYYLQYKNVRPDYVKAIFDVVNWNDVNSRYKKAIGS |
 Top
| |