| Protein: 66500045 XP_392780.2 PREDICTED: eukaryotic translation initiation factor 3 subunit I |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | |||||
| Scape | 55.3 | 44.7 | 1.2371365 | ||
| Brain | |||||
| Crop | |||||
| Eye | |||||
| Intestine | 53.2 | 46.8 | 1.1367521 | ||
| Leg, front | |||||
| Leg, middle | |||||
| Leg, rear | |||||
| Mandibular gland | |||||
| Rectum | |||||
| Salivary gland, cerebral | |||||
| Salivary gland, thoracic | 65.9* | 20.4 | 13.7 | 4.810219 | 1.4890511 |
| Sternite | |||||
| Tergite | |||||
| Ventriculus | 48.6 | 51.4 | 0.9455253 | ||
| Thoracic muscle | |||||
| Fat body | 38 | 38.3 | 23.7 | 1.6033756 | 1.6160338 |
| Malpighian tubules | 39.7 | 23.2 | 37.1 | 1.0700809 | 0.62533695 |
| Nerve chord | 40.3 | 21.3 | 38.5 | 1.0467533 | 0.55324674 |
| Poison sac | |||||
| Sting | |||||
| Heart | 31.8 | 33.7 | 34.5 | 0.9217391 | 0.9768116 |
| Hypopharyngeal gland | 20.1 | 79.9 | 0.25156444 | ||
| Galea | |||||
| Glossa | |||||
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 45.2 | 32.3 | 41.1 | 1.0997567 | 0.7858881 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MKPLMLHGHERAITQIKYNREGDLLFSSSKDKKPNVWYSLNGERLGSFNGHNGSVWCIDV NWDTTRFLSGSGDNTLRVWDCQTGKEIGLLHTNSSVRTCSFSYSANLAVYSTDKALGHQC EMFIMDIKNVDAVLSQADAISRIAVNGPRISAILWGALDETIITGHEDGEITLWDVRTRK KLTSVKGHKSQINDMQFNKDGTMFVTASKDNTAKLFDSESLMLLKTYKTERPVNSATISP IFDHVVLGGGQDAMDVTTTSTRQGKFDSRFFHLVFEEEFARLKGHFGPINSLAFHPNGRS FSTGGEDGYVRINTFDQSYFDFHFEY |
 Top
| |