| Protein: 328791543 XP_623181.2 PREDICTED: MACRO domain-containing protein 2-like isoform 2 |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 30.7 | 39.6 | 29.7 | 1.0336701 | 1.3333334 |
| Scape | 33 | 30.4 | 36.6 | 0.90163934 | 0.8306011 |
| Brain | 36 | 64 | 0.5625 | ||
| Crop | |||||
| Eye | |||||
| Intestine | 25.4 | 36.1 | 38.5 | 0.65974027 | 0.93766236 |
| Leg, front | 30.1 | 33.5 | 36.4 | 0.8269231 | 0.9203297 |
| Leg, middle | 30.7 | 33.8 | 35.4 | 0.86723167 | 0.9548023 |
| Leg, rear | 33.6 | 28.8 | 37.6 | 0.89361703 | 0.7659575 |
| Mandibular gland | 3 | 97 | 0.030927835 | ||
| Rectum | 3.1 | 96.9 | 0.031991743 | ||
| Salivary gland, cerebral | 40.3 | 59.7 | 0.67504185 | ||
| Salivary gland, thoracic | 23.2 | 49 | 27.8 | 0.8345324 | 1.7625899 |
| Sternite | |||||
| Tergite | |||||
| Ventriculus | |||||
| Thoracic muscle | 12.9 | 62.5 | 24.6 | 0.5243902 | 2.5406504 |
| Fat body | 62.3 | 15.1 | 22.6 | 2.756637 | 0.6681416 |
| Malpighian tubules | 39.5 | 33.1 | 27.4 | 1.4416058 | 1.2080292 |
| Nerve chord | 15.4 | 64.4 | 20.2 | 0.76237625 | 3.1881187 |
| Poison sac | |||||
| Sting | |||||
| Heart | 37.4 | 34.8 | 27.8 | 1.3453237 | 1.2517985 |
| Hypopharyngeal gland | 50.5 | 49.5 | 1.020202 | ||
| Galea | |||||
| Glossa | |||||
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 28 | 39.1 | 43 | 0.6511628 | 0.90930235 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MLTHRANIADRFAVIAVVRSTIQNFLIGKNFVTFAKPQSRMSFEVEKQKFLNMPPEEKRK YYKGIINTIDEIPTWFQYWNKNKTNINMIDLEKIEKINEEMANKISIWQGDITSLEIDAI VNAANSSLLGGGGVDGAIHKAAGPNLKKECATLGGCHVGEAKITGGYMLPAKYVIHTVGP QGEKPEKLKECYENSLIVAKENQLRTIAFPCISTGIYGYPQRPAAKVALLTVKKFLTENK NAVDRIIFCLFLKTDKDIYEELLQKYFAID |
 Top
| |