| Protein: 66522973 XP_396387.2 PREDICTED: probable cytochrome P450 6a14 |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 41.1 | 58.9 | 0.6977929 | ||
| Scape | |||||
| Brain | |||||
| Crop | 56 | 44 | 1.2727273 | ||
| Eye | |||||
| Intestine | 67.1 | 32.9 | 2.0395136 | ||
| Leg, front | |||||
| Leg, middle | |||||
| Leg, rear | |||||
| Mandibular gland | |||||
| Rectum | |||||
| Salivary gland, cerebral | |||||
| Salivary gland, thoracic | 10.1* | 59.3 | 30.6 | 0.33006537 | 1.9379085 |
| Sternite | |||||
| Tergite | |||||
| Ventriculus | |||||
| Thoracic muscle | |||||
| Fat body | 22.4 | 18.4 | 59.2 | 0.3783784 | 0.3108108 |
| Malpighian tubules | 68.7 | 31.3 | 2.194888 | ||
| Nerve chord | |||||
| Poison sac | |||||
| Sting | |||||
| Heart | 1.4* | 40.9 | 57.7 | 0.024263432 | 0.7088388 |
| Hypopharyngeal gland | 75.9 | 24.1 | 3.1493776 | ||
| Galea | |||||
| Glossa | |||||
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 26.2 | 55 | 42.3 | 0.61938536 | 1.3002365 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MLLKTSMCHYLKKLCEEYKHEPMIGIFTRKTPILIIQDPDLIKDVLIRDFSKFANRGIPI HEKAEPLSPHLFNLEVERWRPLRTRLSPVFTSGKLKEMFPLILDCAKHLEQYLDKLVLRE EFIECRELTAKYTTDVIGSCAFGIEMNALSDEESEFRRIGRKVFSNSFGQILRFRFRQIF PRIYNLLGFVLPPMEVTKFLTNIIVSTMKYRQENNIVRPDFVNMLIELKKHPDKLENIKL TDTLLTAQAFVFFIAGFETSSSAISNALYELALNPEVQNKLRQEIKEYFNKHNELKYEYI KNMIYLDLVFRETLRKYPPGPLILRKSITNYTFNNTKVSIPEESFVWIPLYAIHHDPKIY PNPDAFIPERFNDDAIATRHPMHYLPFGDGPRNCIGARFAVYQSKIGLITILWNYKVEVC DKTMIPYEINPAAFLLTPKGGIYLKFTKIKNNEEILN |
 Top
| |