| Protein: 328793292 XP_003251860.1 PREDICTED: glucose-6-phosphate 1-epimerase-like |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 34.4 | 22.3 | 43.3 | 0.79445726 | 0.51501155 |
| Scape | 22.7 | 25.3 | 52 | 0.43653846 | 0.48653847 |
| Brain | |||||
| Crop | 29.3 | 70.7 | 0.41442716 | ||
| Eye | |||||
| Intestine | 23.4 | 39.6 | 37 | 0.63243246 | 1.0702703 |
| Leg, front | 37.9 | 62.1 | 0.61030596 | ||
| Leg, middle | |||||
| Leg, rear | |||||
| Mandibular gland | 18.7 | 81.3 | 0.2300123 | ||
| Rectum | |||||
| Salivary gland, cerebral | |||||
| Salivary gland, thoracic | 39.3 | 27.5 | 33.1 | 1.1873112 | 0.83081573 |
| Sternite | |||||
| Tergite | |||||
| Ventriculus | |||||
| Thoracic muscle | |||||
| Fat body | 53.8 | 46.2 | 1.1645021 | ||
| Malpighian tubules | 31.1 | 20.3 | 48.6 | 0.6399177 | 0.41769546 |
| Nerve chord | 8.4 | 73.3 | 18.3 | 0.45901638 | 4.0054646 |
| Poison sac | |||||
| Sting | |||||
| Heart | 31.8 | 35.1 | 33.1 | 0.96072507 | 1.060423 |
| Hypopharyngeal gland | |||||
| Galea | |||||
| Glossa | |||||
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 29.3 | 34.5 | 47.8 | 0.6129707 | 0.7217573 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MAAATSVVVLDRGNNTTCTINLHGATVVSWRVNNQEQLFVSKQAVFDGKKAIRGGIPFVF PQFGAWTFGPPHGFARIVRWNVEKSPERLPSGDVEAIFSIMDSEFTRSMWNYPFKLTYRL ILREKELHFNIGVYNPSKDHTFSFNLLLHTYFKVPDVRRCQITGLHGCTFIDKTRDNQIF QEGRDVVTVCEWTDRIYQNTQPEHIITNVVSGRKMRVQKYNFPDTVVWNPWQEKARDIPD FGDDEFPNMICVESGHVSSPVILLPGTAFEASQILQVM |
 Top
| |