| Protein: 328776281 XP_392726.2 PREDICTED: 40S ribosomal protein S9 |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | |||||
| Scape | 58.8 | 41.2 | 1.4271845 | ||
| Brain | |||||
| Crop | 42.3 | 57.7 | 0.73310226 | ||
| Eye | |||||
| Intestine | 64.2 | 35.8 | 1.7932961 | ||
| Leg, front | |||||
| Leg, middle | |||||
| Leg, rear | |||||
| Mandibular gland | |||||
| Rectum | |||||
| Salivary gland, cerebral | 35.2 | 64.8 | 0.54320985 | ||
| Salivary gland, thoracic | 39.3 | 10.6 | 50.1 | 0.78443116 | 0.21157685 |
| Sternite | 63.5 | 36.5 | 1.7397261 | ||
| Tergite | 91* | 9 | 10.111111 | ||
| Ventriculus | |||||
| Thoracic muscle | |||||
| Fat body | 28.2 | 45.1 | 26.7 | 1.0561798 | 1.6891385 |
| Malpighian tubules | 43.5 | 26.3 | 30.2 | 1.4403974 | 0.87086093 |
| Nerve chord | 62.7 | 37.3 | 1.6809652 | ||
| Poison sac | |||||
| Sting | 66.4 | 33.6 | 1.9761904 | ||
| Heart | 12.6 | 55.3 | 32 | 0.39375 | 1.728125 |
| Hypopharyngeal gland | 21.2 | 78.8 | 0.26903552 | ||
| Galea | |||||
| Glossa | |||||
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 37.1 | 50.6 | 41.1 | 0.9026764 | 1.2311436 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MVNGRIPSVFSKTYVTPRRPYEKARLDQELRIIGEYGLRNKREVWRVKYTLANIRKAARE LLTLEEKDPKRLFEGMK |
 Top
| |