| Protein: 48097876 XP_391965.1 PREDICTED: AP-2 complex subunit mu-1 isoform 1 |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | |||||
| Scape | |||||
| Brain | |||||
| Crop | |||||
| Eye | |||||
| Intestine | 28.4 | 50 | 21.6 | 1.3148148 | 2.3148148 |
| Leg, front | |||||
| Leg, middle | |||||
| Leg, rear | |||||
| Mandibular gland | |||||
| Rectum | |||||
| Salivary gland, cerebral | |||||
| Salivary gland, thoracic | 44.2 | 55.8 | 0.7921147 | ||
| Sternite | |||||
| Tergite | |||||
| Ventriculus | |||||
| Thoracic muscle | |||||
| Fat body | 71 | 29 | 2.4482758 | ||
| Malpighian tubules | 31 | 42.9 | 26.1 | 1.1877395 | 1.6436782 |
| Nerve chord | 33.5 | 22.3 | 44.3 | 0.7562077 | 0.503386 |
| Poison sac | |||||
| Sting | |||||
| Heart | 20.6 | 50.4 | 29 | 0.71034485 | 1.737931 |
| Hypopharyngeal gland | |||||
| Galea | |||||
| Glossa | |||||
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 28.4 | 46.8 | 34.3 | 0.8279883 | 1.3644315 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MIGGLFVYNHKGEVLISRVYRDDIGRNAVDAFRVNVIHARQQVRSPVTNIARTSFFHIKR ANIWLAAVTKQNVNAAMVFEFLLKIIDVMQSYFGKISEENIKNNFVLIYELLDEILDFGY PQNCDTGVLKTFITQQGVKSATKEEQAQITSQVTGQIGWRREGIKYRRNELFLDVLEYVN LLMSPQGQVLSAHVAGKVVMKSYLSGMPECKFGINDKIVMEAKGMKGGSGLGGGGDDPTG ARSGKPVVVIDDCQFHQCVKLSKFETEHAISFIPPDGEFELMRYRTTKDISLPFRVIPLV REVGRTKMEVKAVLKSNFKPSLLGQKIEVRVPTPLNTAGVQLICLKGKAKYKASENAIVW KIKRMAGMKETQLSAEIDLLETDTKKRWTRPPISMNFEVPFAPSGFKVRYLKVFESKLNY SDHDVIKWVRYIGRSGLYETRC |
 Top
| |