| Protein: 328783261 XP_001121450.2 PREDICTED: heparanase-like |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 44.9 | 28.4 | 26.7 | 1.6816479 | 1.0636704 |
| Scape | 60.8 | 10.1 | 29.1 | 2.0893471 | 0.34707904 |
| Brain | |||||
| Crop | |||||
| Eye | |||||
| Intestine | 2.4* | 97.6 | 0.024590164 | ||
| Leg, front | |||||
| Leg, middle | |||||
| Leg, rear | |||||
| Mandibular gland | 6.5 | 93.5 | 0.069518715 | ||
| Rectum | |||||
| Salivary gland, cerebral | |||||
| Salivary gland, thoracic | |||||
| Sternite | |||||
| Tergite | |||||
| Ventriculus | |||||
| Thoracic muscle | |||||
| Fat body | 81 | 19 | 4.263158 | ||
| Malpighian tubules | |||||
| Nerve chord | |||||
| Poison sac | |||||
| Sting | |||||
| Heart | 42.6 | 36.7 | 20.7 | 2.057971 | 1.7729468 |
| Hypopharyngeal gland | 64 | 36 | 1.7777778 | ||
| Galea | |||||
| Glossa | |||||
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 31.4 | 44.1 | 46.1 | 0.68112797 | 0.95661604 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MKIDWQLGNEPNSFNHVFNINITAIQLAYDYHQLRQLLNEIGYSESLLVGPEVNHVGDIN RIGEHYAKTFLENDKNSINYVTWHQYYLNGKEAQLIDFINISIFNYLPKQIKSMQEAIQS SGKIIPMWLSETSTAYGGGAPELSNRFVAGFLWLDKLGYSASAGLNTVIRQSLFEKVLKL SSTSFDYLRLYAHCTPEKSWINKIVAITIYGINLYKYSINVTIQGIPISHKNSKVFLYAL TSNNLQSRDIKINGEVLKLQSNGSLPLFQPIILESTQLITLPSYSMIFIVIHGAYVPACH T |
 Top
| |