| Protein: 66507356 XP_395683.2 PREDICTED: proliferation-associated protein 2G4-like |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 22.8 | 56.9* | 20.3 | 1.1231527 | 2.8029556 |
| Scape | 46.1 | 20.8 | 33.2 | 1.3885542 | 0.62650603 |
| Brain | 52.3 | 47.7 | 1.096436 | ||
| Crop | 42.1 | 57.9 | 0.7271157 | ||
| Eye | |||||
| Intestine | 67.1 | 32.9 | 2.0395136 | ||
| Leg, front | |||||
| Leg, middle | 64.9 | 35.1 | 1.8490028 | ||
| Leg, rear | |||||
| Mandibular gland | 18.4 | 81.6 | 0.2254902 | ||
| Rectum | |||||
| Salivary gland, cerebral | 60.9 | 5.6 | 33.5 | 1.8179104 | 0.16716418 |
| Salivary gland, thoracic | 48.5 | 17 | 34.5 | 1.4057971 | 0.49275362 |
| Sternite | |||||
| Tergite | |||||
| Ventriculus | |||||
| Thoracic muscle | |||||
| Fat body | 40.1 | 33.4 | 26.4 | 1.5189394 | 1.2651515 |
| Malpighian tubules | 29.4 | 34.6 | 36 | 0.81666666 | 0.9611111 |
| Nerve chord | 31.6 | 39.3 | 29.1 | 1.0859107 | 1.3505155 |
| Poison sac | |||||
| Sting | 44.8 | 55.2 | 0.8115942 | ||
| Heart | 22.2 | 34.1 | 43.8 | 0.5068493 | 0.7785388 |
| Hypopharyngeal gland | 19.6 | 80.4 | 0.24378109 | ||
| Galea | |||||
| Glossa | |||||
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 41.1 | 33.4 | 43.2 | 0.9513889 | 0.7731481 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MADKEETERTIAEDIVVTKYKMAGDIVNRVLKQVLDKCVAGASVREICEFGDKLILDETN KVFKKEKELKKGIAFPTCISVNNCICHFSPIASEPDLILKDEDMVKVDLGAHVDGFIAVV AHTIVIGSSPTKKVTGRKADVVLAAHFASQAALRLLQPGTETYTITETVEKICDVYKCKP IEGMLSHQLKQFKIDGEKTIIQNPNDAQKKEHEKYTLEAYEVYAMDVLVSTGEGVGREQD TRVTIFKKTEETYQLKLKASRMFYSEVTHKHGLMPFNLRTFEDEKKAKMAVVECVNHRLI EPFQVLYEKPNEFAAQFKFTVLLMHNRQHKITGIPLDLDIYQSEYVVKDPELKTLLYTSV HPRTTKRMRKKAEKAAGEVTMEVDAKA |
 Top
| |