| Protein: 66566113 XP_624821.1 PREDICTED: 60S ribosomal protein L3 |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 44.4 | 55.6 | 0.79856116 | ||
| Scape | 41.3 | 33.8 | 25 | 1.652 | 1.352 |
| Brain | |||||
| Crop | 5.5* | 47.1 | 47.4 | 0.11603376 | 0.9936709 |
| Eye | 4.4 | 55 | 40.6 | 0.10837439 | 1.3546798 |
| Intestine | 52.6 | 47.4 | 1.1097046 | ||
| Leg, front | |||||
| Leg, middle | 55.8 | 44.2 | 1.2624434 | ||
| Leg, rear | |||||
| Mandibular gland | |||||
| Rectum | |||||
| Salivary gland, cerebral | 85.7 | 14.3 | 5.993007 | ||
| Salivary gland, thoracic | 40.5 | 13.8 | 45.8 | 0.8842795 | 0.30131003 |
| Sternite | 18.8 | 49.7 | 31.5 | 0.5968254 | 1.5777777 |
| Tergite | 37.7 | 62.3 | 0.60513645 | ||
| Ventriculus | |||||
| Thoracic muscle | |||||
| Fat body | 38.6 | 29.1 | 32.2 | 1.1987578 | 0.9037267 |
| Malpighian tubules | 36 | 25.4 | 38.6 | 0.93264246 | 0.6580311 |
| Nerve chord | 40.8 | 15.2 | 44 | 0.92727274 | 0.34545454 |
| Poison sac | |||||
| Sting | 47.8 | 52.2 | 0.91570884 | ||
| Heart | 16.9 | 51.8 | 31.3 | 0.5399361 | 1.654952 |
| Hypopharyngeal gland | 12.4 | 87.6 | 0.14155251 | ||
| Galea | |||||
| Glossa | |||||
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 32.9 | 38.1 | 43.7 | 0.7528604 | 0.87185353 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MSHRKFSAPRHGSMGFYPKKRSQRHRGKVKAFPKDDPSKPVHLTAFIGYKAGMTHVVREA DRPGSKVNKKEIVEAVTILETPPMIVVGVVGYIETPHGLRALTTVWAEHLSEDCRRRFYK NWYKSKKKAFTKASKKWQDDLGRKSIENDFKKIIKYCKVVRIIAHTQMKLLRQRQKKAHI MEIQLNGGTIEQKVQWAREHLEKPVPVSNVFAPDEMIDVIGVTKGKGYKGVTSRWHTKKL PRKTHKGLRKVACIGAWHPSRVSFTVARAGQKGYHHRTEMNKKIYRIGQGIHTKDGKIVK NNASTEYDLTEKTITPMGGFPHYGEVNNDFIMIKGCCMGPKKRVITLRKSLLVHTKRSAL EKINLKFIDTSSKFGHGRFQTAADKTSFMGQLKKDRMREEQQAQATTSAPSAANA |
 Top
| |