| Protein: 110768098 XP_395256.3 PREDICTED: protein extra bases |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | |||||
| Scape | 45.2 | 54.8 | 0.82481754 | ||
| Brain | |||||
| Crop | 34.6 | 65.4 | 0.52905196 | ||
| Eye | |||||
| Intestine | 29.5 | 25.8 | 44.8 | 0.65848213 | 0.57589287 |
| Leg, front | 25.5* | 74.5 | 0.34228188 | ||
| Leg, middle | 32 | 34.9 | 33.1 | 0.9667674 | 1.0543807 |
| Leg, rear | 6.3* | 19.5* | 74.2 | 0.08490566 | 0.26280323 |
| Mandibular gland | |||||
| Rectum | |||||
| Salivary gland, cerebral | |||||
| Salivary gland, thoracic | 42.5 | 28.2 | 29.3 | 1.4505119 | 0.96245736 |
| Sternite | |||||
| Tergite | 84.1 | 15.9 | 5.289308 | ||
| Ventriculus | |||||
| Thoracic muscle | |||||
| Fat body | 31.1 | 34.4 | 34.5 | 0.90144926 | 0.9971014 |
| Malpighian tubules | 14.6 | 67.5 | 17.9 | 0.8156425 | 3.7709496 |
| Nerve chord | 19.2 | 51.6 | 29.2 | 0.65753424 | 1.7671233 |
| Poison sac | |||||
| Sting | 52.1 | 47.9 | 1.0876827 | ||
| Heart | 32.3 | 33.5 | 34.2 | 0.9444444 | 0.9795322 |
| Hypopharyngeal gland | 31.6 | 68.4 | 0.4619883 | ||
| Galea | |||||
| Glossa | |||||
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 32.4 | 37.3 | 44.6 | 0.7264574 | 0.83632284 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MSQKIEKPILSGQRIKTRKRDEKEKYDPMGFRDAILLGLEKAGNDLDAISKYLDAAGSKL DYRRYGEDLFDILIAGGLLVPGGSIAQDGDKPVKTTACVFEQPEDMESMRNFEQVFIKLM RRYKYLEKMFEEEMKKVLVFMKGFTPKERIKLARMTALWISNGSVPPTVLSVLINEHLVK DNLALDFLLEVFVTWRQEKGLSSLMTALKKGNIEGRLMEFVPPNKRTEEYFRSVFEAVGL ADIVKLHKAQASQEAKRDLQQLLLDDLADNRPLKDIILDLKEMAQKSGIPEHEVIGLIWL VVMGQAEWNKKEELVADQALKHLKVYTPLFDAFTTTARSEHALILKVQEFCYENMNFMKV FQKIVLLFYKTDVISEEVILKWYKEGHSVKGKMMFLDQMKKFVEWLQNAEEESESGEEED |
 Top
| |