| Protein: 110750077 XP_393567.3 PREDICTED: spermine synthase-like isoform 1 |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 29.7 | 38.4 | 31.9 | 0.9310345 | 1.2037617 |
| Scape | 31.8 | 39.3 | 29 | 1.0965518 | 1.3551724 |
| Brain | |||||
| Crop | 44.1 | 26 | 30 | 1.47 | 0.8666667 |
| Eye | |||||
| Intestine | 40.6 | 32.1 | 27.2 | 1.492647 | 1.180147 |
| Leg, front | 29.5 | 38 | 32.5 | 0.9076923 | 1.1692308 |
| Leg, middle | 39 | 61 | 0.6393443 | ||
| Leg, rear | 27.6 | 33 | 39.4 | 0.70050764 | 0.83756346 |
| Mandibular gland | |||||
| Rectum | |||||
| Salivary gland, cerebral | |||||
| Salivary gland, thoracic | 26.9 | 28.7 | 44.3 | 0.60722345 | 0.6478555 |
| Sternite | 20.1 | 56.9 | 23 | 0.87391305 | 2.473913 |
| Tergite | |||||
| Ventriculus | |||||
| Thoracic muscle | |||||
| Fat body | 41.5 | 26.9 | 31.7 | 1.3091483 | 0.8485804 |
| Malpighian tubules | 34.5 | 32.7 | 32.8 | 1.0518292 | 0.9969512 |
| Nerve chord | 78.8 | 21.2 | 3.7169812 | ||
| Poison sac | |||||
| Sting | 51.2 | 48.8 | 1.0491803 | ||
| Heart | 31.1 | 37.1 | 31.8 | 0.9779874 | 1.1666666 |
| Hypopharyngeal gland | 38.8 | 61.2 | 0.63398695 | ||
| Galea | 38.4 | 61.6 | 0.6233766 | ||
| Glossa | 94.9* | 5.1 | 18.607843 | ||
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 33 | 43.2 | 36 | 0.9166667 | 1.2 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MVAHTVLLDFTVPSNVIVDVEKRSTLKLAITNVLQEYFDSLKPLTESSIDGSFLVLYTGP RGSLITVRGYTEGLITINIEYYKRDEEEALLDFEQWRYLEADVAMALNSQRSKRLPPVRR GTIYDLYLTLSDDRLLEYDIDKLVFEARSPYQKVQIVHSKSLGNLLVLDELQNISEADLI YTETLMQRGKENYTGKEIVILGGGDGGLLWELLKEKPKFVTMLEIDDVVIKACSQHMRSI CGNCLDKRKGENYEIIVGDCAKTLAHMIEEGRQFDYVFGDLTDIPISPTPHGDAWDFIRL ILNSSMKVLKSTGKYMTHGNGASCPQSLEMYEQVLSQLCVPVTFTKDSAFVPSFFEDWVF YQVSLK |
 Top
| |