| Protein: 328781171 XP_392544.4 PREDICTED: probable elongation factor 1-delta |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | |||||
| Scape | 40.8 | 28.6 | 30.6 | 1.3333334 | 0.9346405 |
| Brain | |||||
| Crop | 28.7 | 34.2 | 37 | 0.77567565 | 0.92432433 |
| Eye | |||||
| Intestine | 22.4 | 40.7 | 36.9 | 0.60704607 | 1.102981 |
| Leg, front | |||||
| Leg, middle | 53.4 | 46.6 | 1.1459228 | ||
| Leg, rear | |||||
| Mandibular gland | |||||
| Rectum | 19.4 | 80.6 | 0.24069479 | ||
| Salivary gland, cerebral | 62.4 | 4.7 | 32.9 | 1.8966565 | 0.14285715 |
| Salivary gland, thoracic | 45 | 20.6 | 34.4 | 1.3081396 | 0.5988372 |
| Sternite | 51.3 | 48.7 | 1.0533881 | ||
| Tergite | 30.9 | 69.1 | 0.447178 | ||
| Ventriculus | 65.6 | 34.4 | 1.9069767 | ||
| Thoracic muscle | |||||
| Fat body | 34.3 | 36.6 | 29.1 | 1.1786941 | 1.2577319 |
| Malpighian tubules | 24.8 | 34.8 | 40.5 | 0.6123457 | 0.85925925 |
| Nerve chord | 44.2 | 17.9 | 37.9 | 1.1662269 | 0.47229552 |
| Poison sac | |||||
| Sting | 44.1 | 55.9 | 0.7889088 | ||
| Heart | 13 | 57 | 30.1 | 0.43189368 | 1.8936877 |
| Hypopharyngeal gland | 16.7 | 83.3 | 0.2004802 | ||
| Galea | 27 | 73 | 0.369863 | ||
| Glossa | |||||
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 33.3 | 35.5 | 47.1 | 0.7070064 | 0.7537155 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MEKSALAQEKVWFDKPSYDKAERLYFERMAKVVSHKIMESCSLKSEVSLTNNCHDNSFLN NNSLTKTKSEKFKDNKLLISENISNDVKNSKCQIKTLKINKDEDELNIQEKENIEEKQKS DNVKNDLKEKEKETSPSNDASKKYNTKEVKEKKNKADTRNRNRKHKNDTKEVKENVTPLI RNKQQLPIQGNQQTTSPILSAGGSLANEVAKARQHIKQSLQCMDDIAAVAGFATPNENKK DILDSSVFQELKNTVEKLEERVKALEIKIRTFVPADPIAVCPAKPQPASKPTQEKADDDE DVDLFGSDSEAKDAEAAKLREERLAAYAAKKAKKPALIAKSNIILDVKPWDDETDMKAME EEVRKIETDGLLWGASKLVPLAFGIHKLQISCVVEDDKVSVDWLTEQIQDIEDYVQSVDI AAFNKV |
 Top
| |