| Protein: 328793032 XP_003251816.1 PREDICTED: hypothetical protein LOC100578392 |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | |||||
| Scape | |||||
| Brain | |||||
| Crop | 2.1* | 97.9 | 0.02145046 | ||
| Eye | |||||
| Intestine | 87.7* | 9.8* | 2.4 | 36.541668 | 4.0833335 |
| Leg, front | |||||
| Leg, middle | |||||
| Leg, rear | |||||
| Mandibular gland | |||||
| Rectum | 14.5 | 17 | 68.5 | 0.21167883 | 0.24817519 |
| Salivary gland, cerebral | |||||
| Salivary gland, thoracic | |||||
| Sternite | |||||
| Tergite | |||||
| Ventriculus | 43.7 | 28 | 28.3 | 1.5441697 | 0.9893993 |
| Thoracic muscle | |||||
| Fat body | |||||
| Malpighian tubules | |||||
| Nerve chord | |||||
| Poison sac | |||||
| Sting | 2.8* | 97.2 | 0.028806584 | ||
| Heart | 97.7* | 2.3 | 42.47826 | ||
| Hypopharyngeal gland | |||||
| Galea | |||||
| Glossa | |||||
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 49.1 | 14.4 | 49.5 | 0.9919192 | 0.29090908 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MLKFTLAILGALAVSSPLEAYKLPSVGSGDLANELQKFVDLIPLEKINAIISLYKQEDAE FQQLLKYFQSSEFKLLITEIESLPEFINILNYQQSAGLDAYYLVNEVNEYLHLPKLKPPF FRAKTSGIRGFLDEVEALIPLDELKNLYQDRLKNSTVFAKFIEKLRSPTAQSLVDKLCAS KNFNNFLSKAKKHGVHLDVVKEHLEKVLGLKASCLN |
 Top
| |