| Protein: 110762818 XP_001120242.1 PREDICTED: synaptobrevin-like isoform 1 |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 11.2 | 67.2* | 21.7 | 0.516129 | 3.096774 |
| Scape | 24.7 | 37.6 | 37.6 | 0.6569149 | 1 |
| Brain | |||||
| Crop | |||||
| Eye | |||||
| Intestine | 38.6 | 27.2 | 34.2 | 1.128655 | 0.79532164 |
| Leg, front | |||||
| Leg, middle | |||||
| Leg, rear | |||||
| Mandibular gland | 34.4 | 65.6 | 0.5243902 | ||
| Rectum | |||||
| Salivary gland, cerebral | |||||
| Salivary gland, thoracic | 60.2 | 8.7 | 31.1 | 1.9356914 | 0.27974278 |
| Sternite | 12 | 40.3 | 47.8 | 0.25104603 | 0.84309626 |
| Tergite | |||||
| Ventriculus | |||||
| Thoracic muscle | |||||
| Fat body | 35.7 | 64.3 | 0.55520993 | ||
| Malpighian tubules | 43.6 | 56.4 | 0.77304965 | ||
| Nerve chord | 38 | 25 | 37 | 1.027027 | 0.6756757 |
| Poison sac | |||||
| Sting | |||||
| Heart | |||||
| Hypopharyngeal gland | 10.9 | 89.1 | 0.12233446 | ||
| Galea | |||||
| Glossa | |||||
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 31.3 | 32.9 | 48.5 | 0.6453608 | 0.6783505 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MDGGGNSRDDMGGPRNSQPASTKKLQQTQATVDEVVGIMKVNVEKVLERDQKLSELENRA DALQQGATQFEQQAGKLKRKFWWKNLKMMIIIGIICVIILIIIIASIVSGSSDSDNSSN |
 Top
| |