| Protein: 66518451 XP_391855.2 PREDICTED: nuclear migration protein nudC-like |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | |||||
| Scape | 37.3 | 22.4 | 40.4 | 0.9232673 | 0.55445546 |
| Brain | 50.2 | 49.8 | 1.0080321 | ||
| Crop | 40.2 | 59.8 | 0.6722408 | ||
| Eye | |||||
| Intestine | 22.1* | 77.9 | 0.28369704 | ||
| Leg, front | 35.2 | 30.7 | 34.2 | 1.0292398 | 0.8976608 |
| Leg, middle | 34.6 | 31.1 | 34.4 | 1.005814 | 0.9040698 |
| Leg, rear | 36.4 | 35.6 | 28 | 1.3 | 1.2714286 |
| Mandibular gland | 3.2 | 96.8 | 0.03305785 | ||
| Rectum | |||||
| Salivary gland, cerebral | |||||
| Salivary gland, thoracic | 39.5 | 26.4 | 34.2 | 1.1549708 | 0.7719298 |
| Sternite | |||||
| Tergite | |||||
| Ventriculus | |||||
| Thoracic muscle | |||||
| Fat body | 71.2 | 28.8 | 2.4722223 | ||
| Malpighian tubules | |||||
| Nerve chord | 40.4 | 27.5 | 32.1 | 1.258567 | 0.8566978 |
| Poison sac | |||||
| Sting | |||||
| Heart | 19.7 | 59.8 | 20.5 | 0.9609756 | 2.9170732 |
| Hypopharyngeal gland | 27.6 | 72.4 | 0.38121548 | ||
| Galea | |||||
| Glossa | |||||
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 35.3 | 33.9 | 46.9 | 0.7526652 | 0.7228145 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MSKNEEKFDGMLLAMAQQHEGGVQELLDTIFSFLARKTDFYTGGGEGAAEKLVTSKFKKY EATALAKAASEKAERAEQEKRRKERLEKKKREEKAEEDKFNSESKIVELTDEQAAKLQEE IDSKKSVKESPAVPGPSGDNAESSKKEEDAEDEEEDEKEKNKLRPNSGNGADLPNYRWTQ TLQDLEIKVPLKVNFSARPKDVSVTITKKRLTCGIKGQPPIIDGDFPHEVKVEESTWVIE DGKVLLLNLEKVNKMQWWAHVVTCDPEISTKKVNPEPSKLSDLDGETRGLVEKMMYDQRQ KELGLPTSDEQKKQDVIKKFMEQHPEMDFSKCKFN |
 Top
| |