| Protein: 328790767 XP_395944.3 PREDICTED: annexin-B9-like |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 25.8 | 50.6 | 23.6 | 1.0932204 | 2.1440678 |
| Scape | 41.2 | 37.4 | 21.4 | 1.9252336 | 1.7476635 |
| Brain | 55.5 | 44.5 | 1.247191 | ||
| Crop | 35.9 | 25.2 | 38.9 | 0.92287916 | 0.6478149 |
| Eye | 25.9 | 43 | 31.1 | 0.8327974 | 1.3826367 |
| Intestine | 19.3 | 44.1 | 36.6 | 0.5273224 | 1.204918 |
| Leg, front | 40.3 | 31.3 | 28.5 | 1.4140351 | 1.0982456 |
| Leg, middle | 38 | 32.8 | 29.2 | 1.3013699 | 1.1232877 |
| Leg, rear | 32.1 | 33 | 34.9 | 0.9197708 | 0.9455587 |
| Mandibular gland | 22.5 | 77.5 | 0.29032257 | ||
| Rectum | 40 | 26.9 | 33.1 | 1.2084593 | 0.8126888 |
| Salivary gland, cerebral | 19.9 | 60.6 | 19.5 | 1.0205128 | 3.1076922 |
| Salivary gland, thoracic | 27.1 | 34.6 | 38.3 | 0.7075718 | 0.9033943 |
| Sternite | 24.3 | 51.3 | 24.4 | 0.99590164 | 2.102459 |
| Tergite | 37.3 | 22 | 40.7 | 0.91646194 | 0.5405405 |
| Ventriculus | 37.4 | 21.7 | 40.9 | 0.91442543 | 0.53056234 |
| Thoracic muscle | |||||
| Fat body | 65 | 12.8 | 22.2 | 2.927928 | 0.5765766 |
| Malpighian tubules | 30.3 | 19.3 | 50.4 | 0.60119045 | 0.3829365 |
| Nerve chord | 22.8 | 46 | 31.2 | 0.7307692 | 1.4743589 |
| Poison sac | 88.8* | 11.2 | 7.928571 | ||
| Sting | 40.3 | 59.7 | 0.67504185 | ||
| Heart | 24.3 | 42.6 | 33.1 | 0.73413897 | 1.2870091 |
| Hypopharyngeal gland | 73.3 | 26.7 | 2.7453184 | ||
| Galea | 49.8 | 20.8 | 29.4 | 1.6938776 | 0.707483 |
| Glossa | 43.1 | 22.5 | 34.4 | 1.2529069 | 0.6540698 |
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 33.4 | 39 | 34.5 | 0.9681159 | 1.1304348 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MSQQQYYPFKCTPTVYPAEPFDANADAALLRKAMKGFGTDEKTIIDVLTRRGIVQRLEVA EAYKTLYGKDLISDLKSELTGKLEDVIIALMTPLPHYYAKELHDAVSGLGTDEEAIVEIL CTLSNYGIRTIAAFYENLYGKSLESDLKGDTSGHFKRLLVSLVQANRDENQGIDQTQAIA DAQALYEAGEKQWGTDESQFNAXXXXXXXXXXXXXXXXXXISGHDIEVAIKKEFSGNLEK GLLGIVKCVKSKVGFFAERLYASMHGIGTKDRTLIRIIVSRSEIDLGDIKKAFEERYGKS LESWIAGDTSGDYKKALLSLVST |
 Top
| |