| Protein: 66548758 XP_393438.2 PREDICTED: v-type proton ATPase subunit d |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 46.9 | 53.1 | 0.88323915 | ||
| Scape | 30.1 | 69.9 | 0.43061516 | ||
| Brain | 28.5 | 71.5 | 0.3986014 | ||
| Crop | 60.7 | 39.3 | 1.5445293 | ||
| Eye | |||||
| Intestine | 37.7 | 20 | 42.2 | 0.8933649 | 0.47393364 |
| Leg, front | 43.1 | 30.3 | 26.6 | 1.6203008 | 1.1390977 |
| Leg, middle | 60.2 | 39.8 | 1.5125629 | ||
| Leg, rear | 34.1 | 28.2 | 37.8 | 0.9021164 | 0.74603176 |
| Mandibular gland | |||||
| Rectum | |||||
| Salivary gland, cerebral | |||||
| Salivary gland, thoracic | 63 | 4.5* | 32.5 | 1.9384615 | 0.13846155 |
| Sternite | |||||
| Tergite | |||||
| Ventriculus | |||||
| Thoracic muscle | |||||
| Fat body | 82.3 | 17.7 | 4.6497173 | ||
| Malpighian tubules | 30 | 41.5 | 28.6 | 1.048951 | 1.451049 |
| Nerve chord | 28.3 | 46.7 | 25 | 1.132 | 1.868 |
| Poison sac | |||||
| Sting | |||||
| Heart | 11.2 | 29.6 | 59.2 | 0.1891892 | 0.5 |
| Hypopharyngeal gland | 63.3 | 36.7 | 1.7247957 | ||
| Galea | 77.2* | 22.8 | 3.3859649 | ||
| Glossa | |||||
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 47.9 | 32.3 | 40.2 | 1.1915423 | 0.8034826 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MKGCMFNIDAGYLEGLCRGFKCGILQQSDYLNLVQCETLEDLKLHLAGTDYGSFLANEPS PLSVSVIDDKLREKLVIEFQHMRNHSVEPLSQFLDFITYSYMIDNIILLITGTLHQRPIS ELIPKCHPLGSFEQMEAIHVAATPAELYNAVLVDTPLAPFFVDCISEQDLDEMNIEIIRN TLYKAYLEAFYKFCKDIGGTTADTMCEILAFEADRRAIIITINSFGTELGKDDRAKLYPR CGKLNPDGLAALARADDYEQVKAVAEYFAEYSALFEGAGNNPGDKTLEDKFFEHEVRLNV HAFLQQFHFGVFYSYLKLKEQECRNIVWIAECVAQKHRAKIDNYIPIF |
 Top
| |