| Protein: 328783450 XP_393211.4 PREDICTED: short/branched chain specific acyl-CoA dehydrogenase mitochondrial-like |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 35.9 | 64.1 | 0.5600624 | ||
| Scape | |||||
| Brain | |||||
| Crop | 21.3* | 78.7 | 0.27064803 | ||
| Eye | |||||
| Intestine | 66.2* | 20.5 | 13.4 | 4.9402986 | 1.5298507 |
| Leg, front | |||||
| Leg, middle | |||||
| Leg, rear | 70.2* | 25.9* | 3.9 | 18 | 6.6410255 |
| Mandibular gland | |||||
| Rectum | |||||
| Salivary gland, cerebral | |||||
| Salivary gland, thoracic | 0.4* | 92.1* | 7.5 | 0.053333335 | 12.28 |
| Sternite | 12 | 50.8 | 37.2 | 0.32258064 | 1.3655914 |
| Tergite | 0.4 | 79.4 | 20.2 | 0.01980198 | 3.9306931 |
| Ventriculus | |||||
| Thoracic muscle | |||||
| Fat body | 5.2 | 46.4 | 48.5 | 0.10721649 | 0.95670104 |
| Malpighian tubules | 24.7* | 7* | 68.3 | 0.36163983 | 0.10248902 |
| Nerve chord | 43.3 | 28.7 | 28.1 | 1.5409253 | 1.0213523 |
| Poison sac | |||||
| Sting | |||||
| Heart | 1.8* | 55.9 | 42.3 | 0.04255319 | 1.321513 |
| Hypopharyngeal gland | |||||
| Galea | 73.3 | 26.7 | 2.7453184 | ||
| Glossa | |||||
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 25.6 | 48 | 36.6 | 0.69945353 | 1.3114754 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MNLFTLQINQISRKIYNKKYLSKCIIRLNHNPGPLSQFTDEEILMKESVNKLAKEEIAPL VRKMEKESKIDEGLIRKLFENGLMGIEIPEKYGGSGCNFMTTILSVEEVAKVDGSVAALI DIHNTLVNSLIKKVATEEQKKRYLPRLAQDYAGSFCLTEPGSGSDAFSLKTIAKKDGSDY VISGTKMWISNSDIAELFLVFANANPSAGYRGITTFFVERDTPGLTIAKPEDKLGIKASG TCMIHFDNVRVPEDNILGHFGHGYKYAAGFLNEGRIGIGAQMIGIAQGCLDATIPYTLER KQFGKDIFSFQSMQHQIAQVVTELESARLLVYNAARLVDIKKDVMKEAAMAKFVASETAL RVTAKCIDFMGGVGFTTDFPQEKYFRDSKIGTIYEGTSNMQLSTIAKCIRKEYS |
 Top
| |