| Protein: 66529931 XP_624852.1 PREDICTED: v-type proton ATPase subunit F 1-like |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 30 | 36.1 | 33.9 | 0.88495576 | 1.0648967 |
| Scape | 31 | 37.8 | 31.1 | 0.99678457 | 1.2154341 |
| Brain | 32.4 | 36.8 | 30.8 | 1.0519481 | 1.1948051 |
| Crop | 32.3 | 35.4 | 32.2 | 1.0031056 | 1.0993788 |
| Eye | |||||
| Intestine | 31.7 | 25.1 | 43.2 | 0.7337963 | 0.5810185 |
| Leg, front | 37.8 | 29.2 | 33 | 1.1454545 | 0.8848485 |
| Leg, middle | 51.6 | 22.2 | 26.2 | 1.9694656 | 0.84732825 |
| Leg, rear | 38.3 | 29.8 | 31.8 | 1.2044026 | 0.9371069 |
| Mandibular gland | |||||
| Rectum | 50.5 | 49.5 | 1.020202 | ||
| Salivary gland, cerebral | 13.8 | 86.2 | 0.1600928 | ||
| Salivary gland, thoracic | 66.5 | 5.4* | 28.1 | 2.366548 | 0.19217081 |
| Sternite | 41 | 35.2 | 23.8 | 1.722689 | 1.4789916 |
| Tergite | 61.1 | 38.9 | 1.5706941 | ||
| Ventriculus | 6.4 | 7.5* | 86.1 | 0.07433217 | 0.087108016 |
| Thoracic muscle | |||||
| Fat body | 47.7 | 31.6 | 20.8 | 2.2932692 | 1.5192307 |
| Malpighian tubules | 33.9 | 30.9 | 35.2 | 0.9630682 | 0.87784094 |
| Nerve chord | 32.5 | 23.7 | 43.8 | 0.7420091 | 0.5410959 |
| Poison sac | |||||
| Sting | |||||
| Heart | 29.1 | 23.6 | 47.4 | 0.613924 | 0.4978903 |
| Hypopharyngeal gland | |||||
| Galea | 67.8 | 32.2 | 2.10559 | ||
| Glossa | |||||
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 38.5 | 28.9 | 39.7 | 0.9697733 | 0.7279597 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MALHSAGKGKLLAVIGDEDTCVGFLLGGVGEINKHRQPNFMVVDKNTAVSDIEDTFKRFI KRDDIDIILINQNVAEMIRHVIDSHTQPIPSVLEIPSKDHPYDATKDSILRRAKGMFNPE DIH |
 Top
| |