![]() |
||||||
| Home | List proteins by tissue | Protein search | Downloads | Links | ||
| Protein: 328775950 XP_001122141.2 PREDICTED: transcriptional activator protein Pur-alpha-like |
Distribution (mouse over here![]() Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 40.4 | 59.6 | 0.67785233 | ||
| Scape | 49.5 | 18.3 | 32.3 | 1.5325078 | 0.5665635 |
| Brain | |||||
| Crop | 25.6 | 36 | 38.4 | 0.6666667 | 0.9375 |
| Eye | |||||
| Intestine | 34.4 | 35.4 | 30.3 | 1.1353135 | 1.1683168 |
| Leg, front | |||||
| Leg, middle | |||||
| Leg, rear | |||||
| Mandibular gland | |||||
| Rectum | |||||
| Salivary gland, cerebral | 47.7 | 24.7 | 27.6 | 1.7282609 | 0.89492756 |
| Salivary gland, thoracic | 42.1 | 24.6 | 33.4 | 1.2604791 | 0.73652697 |
| Sternite | 36.8 | 39.9 | 23.3 | 1.5793991 | 1.7124463 |
| Tergite | |||||
| Ventriculus | |||||
| Thoracic muscle | |||||
| Fat body | 42.4 | 35.2 | 22.4 | 1.8928572 | 1.5714285 |
| Malpighian tubules | 49 | 17.7 | 33.3 | 1.4714714 | 0.5315315 |
| Nerve chord | 47.7 | 14.5 | 37.8 | 1.2619047 | 0.38359788 |
| Poison sac | |||||
| Sting | 37.3 | 62.7 | 0.5948963 | ||
| Heart | 26.2 | 33.1 | 40.7 | 0.64373463 | 0.8132678 |
| Hypopharyngeal gland | 60 | 40 | 1.5 | ||
| Galea | 40.9 | 59.1 | 0.69204736 | ||
| Glossa | |||||
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 40.1 | 32.7 | 38.6 | 1.0388601 | 0.84715027 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MSDRESLDDQPQRYGNPGGMDAGGTDFDPGQQGQQGEQELATKMLQIQSKRFYLDVKQNR RGRFIKVAEIGADGRRSQIYLALSTASEFRNYLSTFSDFYASLGPPNSENVPDDGKLKSE VMTKDNRRYYLDLKENTRGRFLRVSQTITRGGPRTQIAIPAQGMIEFRDALTDLLEEYGT DDGGFKGDLPEGRYMRVDSKNFYFDIGQNNRGIYMRISEVKTHFRTAITVPEKSWERFRD IFADYCERMRERGAGSNVGMNSGGGGNVLPEGRGSVVAQVTQKPAGVKTKTEKRQADQRQ RESLKRRKSLPRQAEPSTINPEKSMSAPASQVPTTTDIPLSSGSAITTSSTSKSTMSEEN VSSGSTASQEIQGVPRLETVQV |
|
| |