| Protein: 328776429 XP_623729.2 PREDICTED: ATPase family AAA domain-containing protein 3 |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 48.9 | 51.1 | 0.95694715 | ||
| Scape | 36 | 33.1 | 30.8 | 1.1688311 | 1.0746753 |
| Brain | 59.2 | 40.8 | 1.4509804 | ||
| Crop | 42.9 | 10.3* | 46.9 | 0.91471213 | 0.2196162 |
| Eye | |||||
| Intestine | 4.6* | 20.5* | 74.9 | 0.06141522 | 0.27369827 |
| Leg, front | 54.6 | 45.4 | 1.2026432 | ||
| Leg, middle | 33 | 30.5 | 36.5 | 0.9041096 | 0.8356164 |
| Leg, rear | 40.4 | 28 | 31.6 | 1.278481 | 0.886076 |
| Mandibular gland | |||||
| Rectum | |||||
| Salivary gland, cerebral | 44.5 | 16.4 | 39.1 | 1.1381074 | 0.41943735 |
| Salivary gland, thoracic | 28.2 | 39.1 | 32.7 | 0.86238533 | 1.1957186 |
| Sternite | 32 | 36.9 | 31.2 | 1.0256411 | 1.1826923 |
| Tergite | |||||
| Ventriculus | |||||
| Thoracic muscle | 61.1 | 38.9 | 1.5706941 | ||
| Fat body | 15.4 | 38.6 | 46 | 0.3347826 | 0.83913046 |
| Malpighian tubules | 27.3 | 23.7 | 49 | 0.55714285 | 0.48367348 |
| Nerve chord | 31.7 | 14.3 | 54 | 0.587037 | 0.26481482 |
| Poison sac | |||||
| Sting | 44.5 | 55.5 | 0.8018018 | ||
| Heart | 29.3 | 21.8 | 48.9 | 0.599182 | 0.44580778 |
| Hypopharyngeal gland | 63.7 | 36.3 | 1.754821 | ||
| Galea | |||||
| Glossa | |||||
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 33.9 | 33.4 | 43.9 | 0.7722096 | 0.76082003 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MSWLFGYRNAQPQDFSQFVQPPASIGSGGGDDRTPPPRISQMEPYRFDSSALERAAAAAK ELEKSMHAKEALELSKMQETTKQMERQAEVKKYEASIEQMKAEQKRIDGEERRKVLQEET KQHQMRAQYQDQLARKRQEESVAKQEAMRKATIEHEMDLRHKNEMKKLEAEIKAKAKIDR ENQDLNLEKIRVKASEKRVTVLESIKTAGSVLGTGMTAFLQDWDKILAAAGGLSLLAFGV YTAKGTTGVAARYIESRLGKPSLVRETSRFTVLDTLRHPIQAVKKLKDKQTDALSGVVLA PKLEERLRDIAIATKNTKLNRGMYRNILMHGPPGTGKTMFAKKLAEHSGMDYAIVTGGDL APLGRDGVTAIHKVFDWAATSRKGLLLFIDEADAFLRKRSSEHISEDLRAMLNAFLYRTG EQSNKFMLILASNTPEQFDWAVNDRLDEMVEFRLPGREERERLVRLYFDKFVLQPAIEGN KRLKIAQFDYSALCSKIAEITDGMSGRELAKLGVTWQATAYASGDGILTEQMVIDKCKEA VKQHKQKVQWQSEQEKQEAKSIYVPEIEIPPIKTKPVVETPSETTSVATA |
 Top
| |