| Protein: 110760701 XP_001120471.1 PREDICTED: 3-hydroxyacyl-CoA dehydrogenase type-2-like |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 29.1 | 33.6 | 37.3 | 0.78016084 | 0.9008043 |
| Scape | 33 | 35.3 | 31.7 | 1.0410094 | 1.1135646 |
| Brain | 63.4 | 36.6 | 1.7322404 | ||
| Crop | 31.4 | 41.2 | 27.4 | 1.1459854 | 1.5036496 |
| Eye | 36.5 | 22.8 | 40.7 | 0.8968059 | 0.5601966 |
| Intestine | 30.9 | 28.2 | 40.9 | 0.7555012 | 0.68948656 |
| Leg, front | 28.8 | 40.8 | 30.4 | 0.94736844 | 1.3421053 |
| Leg, middle | 30.7 | 45.1 | 24.2 | 1.2685951 | 1.8636364 |
| Leg, rear | 57.1 | 28.1 | 14.8 | 3.858108 | 1.8986486 |
| Mandibular gland | 54.8 | 18.1 | 27 | 2.0296297 | 0.67037034 |
| Rectum | 10.6 | 54.5 | 34.9 | 0.3037249 | 1.5616046 |
| Salivary gland, cerebral | 72.5* | 24.3* | 3.2 | 22.65625 | 7.59375 |
| Salivary gland, thoracic | 25.8 | 35.8 | 38.4 | 0.671875 | 0.9322917 |
| Sternite | 16.5 | 51.8 | 31.7 | 0.5205047 | 1.6340694 |
| Tergite | 16.8 | 53.7 | 29.6 | 0.5675676 | 1.8141892 |
| Ventriculus | 21.7 | 23.5 | 54.8 | 0.3959854 | 0.4288321 |
| Thoracic muscle | 21* | 73.7 | 5.4 | 3.8888888 | 13.648149 |
| Fat body | 14.9 | 62.3 | 22.8 | 0.6535088 | 2.7324562 |
| Malpighian tubules | 38.1 | 28.8 | 33.1 | 1.1510574 | 0.87009066 |
| Nerve chord | 26.4 | 27.9 | 45.7 | 0.5776805 | 0.61050326 |
| Poison sac | 60.2 | 39.8 | 1.5125629 | ||
| Sting | 48 | 52 | 0.9230769 | ||
| Heart | 11.9 | 39.7 | 48.4 | 0.24586777 | 0.82024795 |
| Hypopharyngeal gland | 87.5 | 12.5 | 7 | ||
| Galea | 32 | 29.3 | 38.8 | 0.82474226 | 0.7551546 |
| Glossa | 32.7 | 24.1 | 43.1 | 0.75870067 | 0.55916476 |
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 30.6 | 41.6 | 32.5 | 0.94153845 | 1.28 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MKGLVALVTGGASGLGLGVVQRFIKKGAKVVIADLPISKGNTIANELGESAVFTPVDITS TEDVNGAINEIRNKFKKLDVIVNAAGIAVAHKVYNFNKDMPHELTDFNKVLNVNVSGTFN VIRLSLPLMYNNTPDKDGLRGVIINTASVAAFEGQIGQVAYSASKAAIVGMTLPLARDLA SIGVRVVTIAPGIFDTPMLGNLPEKVRVFLQRSVPFPKRLGTPDEYAQLAEHIVENSLLN GEVIRLDGALRMQP |
 Top
| |