![]() |
||||||
| Home | List proteins by tissue | Protein search | Downloads | Links | ||
| Protein: 66563290 XP_392814.2 PREDICTED: t-complex protein 1 subunit gamma |
Distribution (mouse over here![]() Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 14.8* | 44.1 | 41.1 | 0.36009732 | 1.0729927 |
| Scape | 29.7 | 34.3 | 36 | 0.825 | 0.9527778 |
| Brain | |||||
| Crop | 35.5 | 29 | 35.5 | 1 | 0.8169014 |
| Eye | |||||
| Intestine | 26.4 | 36.6 | 37 | 0.7135135 | 0.9891892 |
| Leg, front | 45.7 | 21.4 | 32.9 | 1.3890578 | 0.65045595 |
| Leg, middle | 50.6 | 18.8 | 30.6 | 1.6535947 | 0.6143791 |
| Leg, rear | 56.3 | 43.7 | 1.2883295 | ||
| Mandibular gland | 12.8 | 87.2 | 0.14678898 | ||
| Rectum | |||||
| Salivary gland, cerebral | 87.5 | 12.5 | 7 | ||
| Salivary gland, thoracic | 24.2 | 44.3 | 31.5 | 0.768254 | 1.4063492 |
| Sternite | |||||
| Tergite | 90.2 | 9.8 | 9.204082 | ||
| Ventriculus | |||||
| Thoracic muscle | |||||
| Fat body | 41.6 | 24 | 34.4 | 1.2093023 | 0.6976744 |
| Malpighian tubules | 32.3 | 27.5 | 40.2 | 0.8034826 | 0.6840796 |
| Nerve chord | 24.2 | 29.3 | 46.5 | 0.5204301 | 0.6301075 |
| Poison sac | |||||
| Sting | 55.8 | 44.2 | 1.2624434 | ||
| Heart | 24.6 | 32.7 | 42.7 | 0.5761124 | 0.765808 |
| Hypopharyngeal gland | 36.3 | 63.7 | 0.56985873 | ||
| Galea | |||||
| Glossa | |||||
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 39.8 | 33.4 | 39.4 | 1.0101523 | 0.84771574 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MFGPGAAPIVVLSQNTKRDVGRKVQRENIQAGKAIADVIRTCLGPQAMLKMLMDPMGGIV MTNDGNAILREITVQHPAGKSMIEIARTQDEEVGDGTTSVIVLAGEILATAEPFLEQNMH PTVIIRAYRQALEDIVTILNEQVSIDLDCNDKNKMIQVINSCVRTKFIGRWCELACQIAL DAVYTVLLEENGRREIDIKRYAKVEKIPGGTIEDSTVLKGVMFNKDVTHPKMRRHIKNPR IVLLDCSLEYKKGESQTNIEIMKDTDFTRILELEEEFVKKMCEDIISVKPDVVITEKGVS DLAQHYLVKAGISAIRRLRKSDINRIARACGATVVNRTEELRDEDVGTRAGLFEIKKVGD EYFCFITECKDPKACTIILRGASKDVLNETERNLQDALHVARNLLIEPKLVPGGGAVEMA VSRLLTEKAARLAGVEQWPYKAVAQALEIIPRTLAQNCGANTIRTLTALRAKHATEGMTW GIDGETGQLVDMKEHGIWEPLSVKLQTYKTAIETAILLLRIDDIVSGSKKKKADNEPTPP AQVSEESMKD |
|
| |