![]() |
||||||
| Home | List proteins by tissue | Protein search | Downloads | Links | ||
| Protein: 328793715 XP_393002.3 PREDICTED: enoyl-CoA hydratase domain-containing protein 2 mitochondrial-like isoform 1 |
Distribution (mouse over here![]() Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | |||||
| Scape | |||||
| Brain | |||||
| Crop | |||||
| Eye | |||||
| Intestine | 59.2 | 40.8 | 1.4509804 | ||
| Leg, front | |||||
| Leg, middle | |||||
| Leg, rear | |||||
| Mandibular gland | |||||
| Rectum | |||||
| Salivary gland, cerebral | |||||
| Salivary gland, thoracic | |||||
| Sternite | |||||
| Tergite | |||||
| Ventriculus | |||||
| Thoracic muscle | |||||
| Fat body | 71 | 29 | 2.4482758 | ||
| Malpighian tubules | 40.4 | 18.4 | 41.2 | 0.98058254 | 0.44660193 |
| Nerve chord | |||||
| Poison sac | |||||
| Sting | |||||
| Heart | |||||
| Hypopharyngeal gland | |||||
| Galea | |||||
| Glossa | |||||
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 49.5 | 37 | 1.3378378 | ||
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MGPLTTRVKYTFHSLCTIAIRALSTNVMLNPKNDVKEIVLKYLDGKDNGIVVLGLNRPTA SNALGKTLTSQLNDAISSIREDTKLRVLIIRSLVPKIFCAGADLRERRRMDNSEILKFVS FLRSITNSIETLPTPVISAIDGTALGGGLELALATDIRVAASDSKMGLVETKWAIIPGAG GTQRLPRIIGIAKAKELIYTARIVDGEQAMEIGLINQVVPQNKSGDAAYQTALTIAREIL PNGPIGVKMAKIAMSKGLQVSITDGLEVEKQCYSKVVDTKDRIEGLAAFITKRIPVYQGM |
|
| |